| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342439.1 | internal | 266 | 3-800(+) |
Amino Acid sequence : | |||
| TRFTSNPALLAQPMAFQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVF AWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKLPDPSSTDNAEFQIVLTLIRDGLKADPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAI NVNDSVTKSKFDNLYGCRPSLPDGLM | |||
Physicochemical properties | |||
| Number of amino acids: | 266 | ||
| Molecular weight: | 26,672.674 | ||
| Theoretical pI: | 4.854 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 42.370 | ||
| aromaticity | 0.027 | ||
| GRAVY | 0.024 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.284 | ||
| sheet | 0.323 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342439.1 | 5prime_partial | 257 | 800-27(-) |
Amino Acid sequence : | |||
| HKSIRQRWAASVQVIELALGDGIIDIDGREKQSAISLHLIQPLHTSSCFLRNTNQSLLHLPVLGGIGLQPISDQRQHYLKLRIIGRAGVRQLPTFLVLLLRFDALVNQQRGITAVVDDEI GAAARPPIEGPLGAPPVLLQGFALPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGEGLDEDGSLDGHVETSGDAGTLEGLGGTELGPAGNEARHLHLGELDFEAAEVGLGHVLDLV LAARGGLLNLEGHGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 26,672.674 | ||
| Theoretical pI: | 4.854 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 42.370 | ||
| aromaticity | 0.027 | ||
| GRAVY | 0.024 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.284 | ||
| sheet | 0.323 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342439.1 | internal | 266 | 3-800(+) |
Amino Acid sequence : | |||
| TRFTSNPALLAQPMAFQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVF AWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKLPDPSSTDNAEFQIVLTLIRDGLKADPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAI NVNDSVTKSKFDNLYGCRPSLPDGLM | |||
Physicochemical properties | |||
| Number of amino acids: | 266 | ||
| Molecular weight: | 26,672.674 | ||
| Theoretical pI: | 4.854 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 42.370 | ||
| aromaticity | 0.027 | ||
| GRAVY | 0.024 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.284 | ||
| sheet | 0.323 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342439.1 | 5prime_partial | 257 | 800-27(-) |
Amino Acid sequence : | |||
| HKSIRQRWAASVQVIELALGDGIIDIDGREKQSAISLHLIQPLHTSSCFLRNTNQSLLHLPVLGGIGLQPISDQRQHYLKLRIIGRAGVRQLPTFLVLLLRFDALVNQQRGITAVVDDEI GAAARPPIEGPLGAPPVLLQGFALPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGEGLDEDGSLDGHVETSGDAGTLEGLGGTELGPAGNEARHLHLGELDFEAAEVGLGHVLDLV LAARGGLLNLEGHGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 26,672.674 | ||
| Theoretical pI: | 4.854 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 42.370 | ||
| aromaticity | 0.027 | ||
| GRAVY | 0.024 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.284 | ||
| sheet | 0.323 | ||