| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342443.1 | complete | 117 | 140-493(+) |
Amino Acid sequence : | |||
| MDDPITEGPNMSKVIGNARGMDISSSRGEDITLVLYADFAFTSGKFKGSSLSLFSRNPVMESRREVAVVGGRGKFKMATGMASVTSYYMDVTTGDAILEYNVEVIYPSGLGVMKSDA* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 12,551.153 | ||
| Theoretical pI: | 5.037 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
| Instability index: | 38.950 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.068 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.299 | ||
| sheet | 0.239 | ||