Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342443.1 | complete | 117 | 140-493(+) |
Amino Acid sequence : | |||
MDDPITEGPNMSKVIGNARGMDISSSRGEDITLVLYADFAFTSGKFKGSSLSLFSRNPVMESRREVAVVGGRGKFKMATGMASVTSYYMDVTTGDAILEYNVEVIYPSGLGVMKSDA* | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 12,551.153 | ||
Theoretical pI: | 5.037 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
Instability index: | 38.950 | ||
aromaticity | 0.085 | ||
GRAVY | -0.068 | ||
Secondary Structure Fraction | |||
Helix | 0.282 | ||
turn | 0.299 | ||
sheet | 0.239 |