| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342445.1 | 5prime_partial | 247 | 3-746(+) |
Amino Acid sequence : | |||
| TRKVLGLRPSVKRFPLYQQGCFAGGTVLRMAKDLAENNAGARVLVVCSEITAVTFRGPSETHLDSLVGQALFGDGAAALIVGSDPIVGVERPLFQMVSAAQTILPDSDGAIDGHLREVGL TFHLLKDVPGLISKNIEKSLKEAFGPLGISDWNSVFWIAHPGGPAILDQVEVKLGLKPEKLRSTRHVLSEYGNMSSACVLFILDEMRKASAKEGLSTTGEGLDWGVLFGFGPGLTVETVV LHSVPLN* | |||
Physicochemical properties | |||
| Number of amino acids: | 247 | ||
| Molecular weight: | 12,208.633 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27500 27750 | ||
| Instability index: | 113.829 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.339 | ||
Secondary Structure Fraction | |||
| Helix | 0.142 | ||
| turn | 0.425 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342445.1 | 3prime_partial | 160 | 482-3(-) |
Amino Acid sequence : | |||
| MRYPEHRIPVRNSQRPKRLLQALFYVLGDEPRHIFQEMEGQPHFPQVAVDRPVAVREDRLRRRHHLEQRPLHPNDGVGADDERSGAVAEEGLADEAVEMSLAGAAEGDGGDLRADNQNPS AGVVLGEVLGHAEDGAAGEAALLVQREALDGGAEAEDFTG | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 12,208.633 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27500 27750 | ||
| Instability index: | 113.829 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.339 | ||
Secondary Structure Fraction | |||
| Helix | 0.142 | ||
| turn | 0.425 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342445.1 | 5prime_partial | 120 | 1-363(+) |
Amino Acid sequence : | |||
| APVKSSASAPPSSASLCTSRAASPAAPSSAWPRTSPRTTPALGFWLSALRSPPSPSAAPARLISTASSARPSSATAPLRSSSAPTPSLGWSGLCSRWCRRRRRSSLTATGRSTATCGKWG * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 12,208.633 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27500 27750 | ||
| Instability index: | 113.829 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.339 | ||
Secondary Structure Fraction | |||
| Helix | 0.142 | ||
| turn | 0.425 | ||
| sheet | 0.250 | ||