| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342460.1 | internal | 255 | 1-765(+) |
Amino Acid sequence : | |||
| APVNGEGEDGRMKSAIGIGTLLMDGLGDTIRVSLTEPPEEEIDPCRRLANLGMKTSELQKGVTPFEEKHRHYFDFQRRTGQLPVQKEGEEVDYRGVLHRDGSVLMSVSLDQLKAPELLYK SLATKLVIGMPFKDLATVDSILLRELPPQEDKDARLALKRLIDVSMGVITPLSEQLTKPLPNALALVTLKELSSGAHQLLPEGTRLAVSVRGDESHEELDILKTTDATMILHHIPYSDDK TSRVHAARTLFEYLS | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 28,269.077 | ||
| Theoretical pI: | 5.436 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
| Instability index: | 44.747 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.313 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.208 | ||
| sheet | 0.322 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342460.1 | internal | 255 | 1-765(+) |
Amino Acid sequence : | |||
| APVNGEGEDGRMKSAIGIGTLLMDGLGDTIRVSLTEPPEEEIDPCRRLANLGMKTSELQKGVTPFEEKHRHYFDFQRRTGQLPVQKEGEEVDYRGVLHRDGSVLMSVSLDQLKAPELLYK SLATKLVIGMPFKDLATVDSILLRELPPQEDKDARLALKRLIDVSMGVITPLSEQLTKPLPNALALVTLKELSSGAHQLLPEGTRLAVSVRGDESHEELDILKTTDATMILHHIPYSDDK TSRVHAARTLFEYLS | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 28,269.077 | ||
| Theoretical pI: | 5.436 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
| Instability index: | 44.747 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.313 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.208 | ||
| sheet | 0.322 | ||