| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342462.1 | 3prime_partial | 215 | 2-646(+) |
Amino Acid sequence : | |||
| MMFDAKFESQTAPLFVQATKFNSERSRLAQSFDYNYGDFIPLLRPFLKGYLAKCRDLQSRRLAFFNNYYVEKRRKIMAENGEKHKISCAIDHIIDAQMKGEISEANVLYIVENINVAAIE TTLWSMEWAIAELANHPTIQQKIRDEISAVLGKQSVTESNLLQLPYLQATINETLRLHSPIPLLVPHMNQEEATLGGYTIPKESKVVVNAWWLSN | |||
Physicochemical properties | |||
| Number of amino acids: | 215 | ||
| Molecular weight: | 24,665.052 | ||
| Theoretical pI: | 6.529 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 34045 | ||
| Instability index: | 55.693 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.235 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.205 | ||
| sheet | 0.298 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342462.1 | 3prime_partial | 215 | 2-646(+) |
Amino Acid sequence : | |||
| MMFDAKFESQTAPLFVQATKFNSERSRLAQSFDYNYGDFIPLLRPFLKGYLAKCRDLQSRRLAFFNNYYVEKRRKIMAENGEKHKISCAIDHIIDAQMKGEISEANVLYIVENINVAAIE TTLWSMEWAIAELANHPTIQQKIRDEISAVLGKQSVTESNLLQLPYLQATINETLRLHSPIPLLVPHMNQEEATLGGYTIPKESKVVVNAWWLSN | |||
Physicochemical properties | |||
| Number of amino acids: | 215 | ||
| Molecular weight: | 24,665.052 | ||
| Theoretical pI: | 6.529 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 34045 | ||
| Instability index: | 55.693 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.235 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.205 | ||
| sheet | 0.298 | ||