| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342472.1 | complete | 193 | 117-698(+) |
Amino Acid sequence : | |||
| MFLLDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKERFAESKKELDALLSDEALA TVPFLILGNKIDIPYAASEDELRYHLGLTGVTTGKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWVSQYIN* | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 21,887.021 | ||
| Theoretical pI: | 6.430 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36900 36900 | ||
| Instability index: | 24.953 | ||
| aromaticity | 0.119 | ||
| GRAVY | -0.102 | ||
Secondary Structure Fraction | |||
| Helix | 0.373 | ||
| turn | 0.176 | ||
| sheet | 0.290 | ||