| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342477.1 | 3prime_partial | 231 | 28-720(+) |
Amino Acid sequence : | |||
| MDRECHPKLKGGRRESKYSHGYSPSELQTLASISEVLLPPISSNPDQDFIYQNPHLPDEVAEMATKRGFLEARILVRGLLMLLSTRIGTFFICGSLGLTMEWPFFNKFNQISLENREKVV QKWFKHWFFTPVRLAFVFLKFLVLFVFFTQVGEDSKNPAWKAIGYEVDKTHDSSNSPKNRPLDDGIIETEHETESSLSDSLAHKGLKVVQNPLDNTLRVQCDVVVLGSGCG | |||
Physicochemical properties | |||
| Number of amino acids: | 231 | ||
| Molecular weight: | 26,220.699 | ||
| Theoretical pI: | 6.387 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28210 | ||
| Instability index: | 35.421 | ||
| aromaticity | 0.104 | ||
| GRAVY | -0.254 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.251 | ||
| sheet | 0.234 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342477.1 | 3prime_partial | 231 | 28-720(+) |
Amino Acid sequence : | |||
| MDRECHPKLKGGRRESKYSHGYSPSELQTLASISEVLLPPISSNPDQDFIYQNPHLPDEVAEMATKRGFLEARILVRGLLMLLSTRIGTFFICGSLGLTMEWPFFNKFNQISLENREKVV QKWFKHWFFTPVRLAFVFLKFLVLFVFFTQVGEDSKNPAWKAIGYEVDKTHDSSNSPKNRPLDDGIIETEHETESSLSDSLAHKGLKVVQNPLDNTLRVQCDVVVLGSGCG | |||
Physicochemical properties | |||
| Number of amino acids: | 231 | ||
| Molecular weight: | 26,220.699 | ||
| Theoretical pI: | 6.387 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28210 | ||
| Instability index: | 35.421 | ||
| aromaticity | 0.104 | ||
| GRAVY | -0.254 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.251 | ||
| sheet | 0.234 | ||