| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342494.1 | internal | 236 | 2-709(+) |
Amino Acid sequence : | |||
| GVEKPFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTTLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLF AGVVDGRNIWANDLAASITALHALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIVEVNALAKALAGHKDEAFFSANAAAQASRKSSPRVNNEAVQKAAAAL | |||
Physicochemical properties | |||
| Number of amino acids: | 236 | ||
| Molecular weight: | 25,137.383 | ||
| Theoretical pI: | 5.139 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
| Instability index: | 24.248 | ||
| aromaticity | 0.085 | ||
| GRAVY | 0.181 | ||
Secondary Structure Fraction | |||
| Helix | 0.339 | ||
| turn | 0.212 | ||
| sheet | 0.343 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342494.1 | internal | 236 | 2-709(+) |
Amino Acid sequence : | |||
| GVEKPFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTTLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLF AGVVDGRNIWANDLAASITALHALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIVEVNALAKALAGHKDEAFFSANAAAQASRKSSPRVNNEAVQKAAAAL | |||
Physicochemical properties | |||
| Number of amino acids: | 236 | ||
| Molecular weight: | 25,137.383 | ||
| Theoretical pI: | 5.139 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
| Instability index: | 24.248 | ||
| aromaticity | 0.085 | ||
| GRAVY | 0.181 | ||
Secondary Structure Fraction | |||
| Helix | 0.339 | ||
| turn | 0.212 | ||
| sheet | 0.343 | ||