Acc_NO	ORF type	length	start-end position (strand +/-)
>DY342498.1	5prime_partial	162	563-75(-)
Amino Acid sequence :
TREMPMAAAAKPSSALLVRSMAAQKPLPSATKTVSSKKSTVSTPKLLTRVEQLRLLSKAEKAGLLSAAEKSGLSLSVIERLGLLSKAEELGVLSAATDPGTASALLNVSLILLVLGPAFV YLVPEDYPWEIGLQIAVALISIVGGSAAFAASNLLSTLQKSN*
Physicochemical properties
Number of amino acids:		162
Molecular weight:		12,155.856
Theoretical pI:		10.672
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11000 11125
Instability index:		74.397
aromaticity		0.035
GRAVY		-0.446
Secondary Structure Fraction
Helix		0.183
turn		0.348
sheet		0.296

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY342498.1	complete	115	110-457(+)
Amino Acid sequence :
MQQRRQNHQQWKSKRLQSASQFPKGNLRAQDTQMLAPKPAKSSSHSEEPTQFLDPWLRKAPPILLPLRGALASLSPTAIAPISPPPIAGLLSPPCSGAAAAPPASTASASKLCSS*
Physicochemical properties
Number of amino acids:		115
Molecular weight:		12,155.856
Theoretical pI:		10.672
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11000 11125
Instability index:		74.397
aromaticity		0.035
GRAVY		-0.446
Secondary Structure Fraction
Helix		0.183
turn		0.348
sheet		0.296