| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342524.1 | 5prime_partial | 203 | 3-614(+) |
Amino Acid sequence : | |||
| TRLTLAMYGDGAANPWQLFEALNMAALWDLPAILVCENNHYGMGTAEWRAAKSPAYYKRGDYVPGLKVDGMDALAVKQACKFAKEHVLKNGPIILEMDTYRYHGHSMSDPGSTYRTRDEI SGIRQERDPIERIRKLILAHDIASEKELKDTEKEVRKEVDEAIAQAKESPMPDSSELFTNVYVKGLGTESFGADRKEVRVQLP* | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 11,273.340 | ||
| Theoretical pI: | 9.489 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 6000 | ||
| Instability index: | 37.042 | ||
| aromaticity | 0.040 | ||
| GRAVY | 0.257 | ||
Secondary Structure Fraction | |||
| Helix | 0.340 | ||
| turn | 0.240 | ||
| sheet | 0.180 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342524.1 | complete | 100 | 311-9(-) |
Amino Acid sequence : | |||
| MISVGVHFKNNWSILENMLLCELAGLFHSKGIHSIDLQTRNIISSLVICRTLRCPPFCCAHSIVIILANQNCGQIPQRCHVQCLKQLPRVSGTISIHRKR* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,273.340 | ||
| Theoretical pI: | 9.489 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 6000 | ||
| Instability index: | 37.042 | ||
| aromaticity | 0.040 | ||
| GRAVY | 0.257 | ||
Secondary Structure Fraction | |||
| Helix | 0.340 | ||
| turn | 0.240 | ||
| sheet | 0.180 | ||