Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342524.1 | 5prime_partial | 203 | 3-614(+) |
Amino Acid sequence : | |||
TRLTLAMYGDGAANPWQLFEALNMAALWDLPAILVCENNHYGMGTAEWRAAKSPAYYKRGDYVPGLKVDGMDALAVKQACKFAKEHVLKNGPIILEMDTYRYHGHSMSDPGSTYRTRDEI SGIRQERDPIERIRKLILAHDIASEKELKDTEKEVRKEVDEAIAQAKESPMPDSSELFTNVYVKGLGTESFGADRKEVRVQLP* | |||
Physicochemical properties | |||
Number of amino acids: | 203 | ||
Molecular weight: | 11,273.340 | ||
Theoretical pI: | 9.489 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 6000 | ||
Instability index: | 37.042 | ||
aromaticity | 0.040 | ||
GRAVY | 0.257 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.240 | ||
sheet | 0.180 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342524.1 | complete | 100 | 311-9(-) |
Amino Acid sequence : | |||
MISVGVHFKNNWSILENMLLCELAGLFHSKGIHSIDLQTRNIISSLVICRTLRCPPFCCAHSIVIILANQNCGQIPQRCHVQCLKQLPRVSGTISIHRKR* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,273.340 | ||
Theoretical pI: | 9.489 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 6000 | ||
Instability index: | 37.042 | ||
aromaticity | 0.040 | ||
GRAVY | 0.257 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.240 | ||
sheet | 0.180 |