Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342535.1 | internal | 254 | 2-763(+) |
Amino Acid sequence : | |||
GVEKPFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTTLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLF AGVVDGRNIWANDLAASITALHALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIVEVNALAKALAGHKDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALRGSD HRRATNVSARLDAQ | |||
Physicochemical properties | |||
Number of amino acids: | 254 | ||
Molecular weight: | 27,129.504 | ||
Theoretical pI: | 5.632 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
Instability index: | 25.326 | ||
aromaticity | 0.079 | ||
GRAVY | 0.072 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.213 | ||
sheet | 0.335 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342535.1 | internal | 254 | 2-763(+) |
Amino Acid sequence : | |||
GVEKPFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTTLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLF AGVVDGRNIWANDLAASITALHALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIVEVNALAKALAGHKDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALRGSD HRRATNVSARLDAQ | |||
Physicochemical properties | |||
Number of amino acids: | 254 | ||
Molecular weight: | 27,129.504 | ||
Theoretical pI: | 5.632 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
Instability index: | 25.326 | ||
aromaticity | 0.079 | ||
GRAVY | 0.072 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.213 | ||
sheet | 0.335 |