Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342541.1 | 3prime_partial | 242 | 1-726(+) |
Amino Acid sequence : | |||
MVEEFLKPVVKLGGETLTISQVAAIAARDDGVAVELAEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTESNHTLPHTATRAAMLVRINT LLQGYSGIRFEIMEAITKFLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEPLNADQAFKLAGVNGGFFELQPKEGLALVNGTAVGSGLASIALFDANVLAVLSEVM SA | |||
Physicochemical properties | |||
Number of amino acids: | 242 | ||
Molecular weight: | 15,837.492 | ||
Theoretical pI: | 7.646 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 87.373 | ||
aromaticity | 0.059 | ||
GRAVY | -0.597 | ||
Secondary Structure Fraction | |||
Helix | 0.151 | ||
turn | 0.461 | ||
sheet | 0.217 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342541.1 | 3prime_partial | 152 | 272-727(+) |
Amino Acid sequence : | |||
MLEYSEMGQNPTTHYPTQQQEQPCSSESTLFCRDIPASDSKSWKPSPNSSTTTSLPASPSAAPSPPPVTSSPCPTSLAFSPAAPTPKPLAPPENPSTPTKPSSSPASTAASLNSSPRKAS PSSTAPPSAPDWPRLLSSTPTFLLFYLKLCPP | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 15,837.492 | ||
Theoretical pI: | 7.646 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 87.373 | ||
aromaticity | 0.059 | ||
GRAVY | -0.597 | ||
Secondary Structure Fraction | |||
Helix | 0.151 | ||
turn | 0.461 | ||
sheet | 0.217 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342541.1 | 3prime_partial | 242 | 1-726(+) |
Amino Acid sequence : | |||
MVEEFLKPVVKLGGETLTISQVAAIAARDDGVAVELAEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTESNHTLPHTATRAAMLVRINT LLQGYSGIRFEIMEAITKFLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEPLNADQAFKLAGVNGGFFELQPKEGLALVNGTAVGSGLASIALFDANVLAVLSEVM SA | |||
Physicochemical properties | |||
Number of amino acids: | 242 | ||
Molecular weight: | 15,837.492 | ||
Theoretical pI: | 7.646 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 87.373 | ||
aromaticity | 0.059 | ||
GRAVY | -0.597 | ||
Secondary Structure Fraction | |||
Helix | 0.151 | ||
turn | 0.461 | ||
sheet | 0.217 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342541.1 | 3prime_partial | 152 | 272-727(+) |
Amino Acid sequence : | |||
MLEYSEMGQNPTTHYPTQQQEQPCSSESTLFCRDIPASDSKSWKPSPNSSTTTSLPASPSAAPSPPPVTSSPCPTSLAFSPAAPTPKPLAPPENPSTPTKPSSSPASTAASLNSSPRKAS PSSTAPPSAPDWPRLLSSTPTFLLFYLKLCPP | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 15,837.492 | ||
Theoretical pI: | 7.646 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 87.373 | ||
aromaticity | 0.059 | ||
GRAVY | -0.597 | ||
Secondary Structure Fraction | |||
Helix | 0.151 | ||
turn | 0.461 | ||
sheet | 0.217 |