| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342545.1 | 5prime_partial | 249 | 2-751(+) |
Amino Acid sequence : | |||
| RDENVYMAKLAEQAERYEEMVEFMEKVVGAVDGDELSVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNESHVSAIKSYRSKIESELSSICDGILKLLDTKLIGSAATGDSKVFY LKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDEEI KEAPKPDNE* | |||
Physicochemical properties | |||
| Number of amino acids: | 249 | ||
| Molecular weight: | 28,068.134 | ||
| Theoretical pI: | 4.758 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27515 | ||
| Instability index: | 39.507 | ||
| aromaticity | 0.076 | ||
| GRAVY | -0.506 | ||
Secondary Structure Fraction | |||
| Helix | 0.281 | ||
| turn | 0.197 | ||
| sheet | 0.349 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342545.1 | 5prime_partial | 249 | 2-751(+) |
Amino Acid sequence : | |||
| RDENVYMAKLAEQAERYEEMVEFMEKVVGAVDGDELSVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNESHVSAIKSYRSKIESELSSICDGILKLLDTKLIGSAATGDSKVFY LKMKGDYHRYLAEFKTGAERKEAAENTLSAYKSAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDEEI KEAPKPDNE* | |||
Physicochemical properties | |||
| Number of amino acids: | 249 | ||
| Molecular weight: | 28,068.134 | ||
| Theoretical pI: | 4.758 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27515 | ||
| Instability index: | 39.507 | ||
| aromaticity | 0.076 | ||
| GRAVY | -0.506 | ||
Secondary Structure Fraction | |||
| Helix | 0.281 | ||
| turn | 0.197 | ||
| sheet | 0.349 | ||