Acc_NO	ORF type	length	start-end position (strand +/-)
>DY342559.1	complete	214	81-725(+)
Amino Acid sequence :
MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVAADLRASIWKQMADAGIKYIPSNTFSYYDQVLDTTAMLGAVPPRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFI VPELGPDVKFSYASHKAVNEYKEAKALGVDTVPVLVGPVTYLLLSKPAKGVEKTFPLLSLLDKILPIYKEVIAELKAAGASWIQFDEPTLVLGS*
Physicochemical properties
Number of amino acids:		214
Molecular weight:		23,669.999
Theoretical pI:		5.952
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		43890 43890
Instability index:		24.679
aromaticity		0.121
GRAVY		-0.042
Secondary Structure Fraction
Helix		0.336
turn		0.234
sheet		0.290