| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342565.1 | internal | 250 | 3-752(+) |
Amino Acid sequence : | |||
| HTHSLSDPSQEAEMAYSGAIRSSFLPLLNSDEFTSLSRSTAALPIRNQKFCVGAVLHQDGANDVVAGEISTARKPRALSFSGEKPATPILDTINYPNHMKNLSVEELERLADELREEIVY TVSKTGGHLSSSLGVSELTVALHHVFNTPDDKIIWDVGHQAYPHKILTGRRSRMHTIRQTFGLAGFPKRDESPHDAFGAGHSSTSISAGLGMAVGRDLLKKNNHVISVIGDGAMTAGQAY EALNNAGYLD | |||
Physicochemical properties | |||
| Number of amino acids: | 250 | ||
| Molecular weight: | 12,064.907 | ||
| Theoretical pI: | 6.887 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 84.361 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.991 | ||
Secondary Structure Fraction | |||
| Helix | 0.179 | ||
| turn | 0.339 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342565.1 | complete | 153 | 479-18(-) |
Amino Acid sequence : | |||
| MSDIPNDFIIRRVEHVMKCNSELRYAQARAQMPSRFRHRVHNLLPQFIRQSLQFLHAQILHVIRIVDRIQNRRRRLLPRETQRSRFPRRRNLPRNDVVRSVLVKHRPHAKLLISDRESGG GSRKRGEFVGIEEWEETASDSSGIRHFCLLRWI* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 12,064.907 | ||
| Theoretical pI: | 6.887 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 84.361 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.991 | ||
Secondary Structure Fraction | |||
| Helix | 0.179 | ||
| turn | 0.339 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342565.1 | 5prime_partial | 112 | 2-340(+) |
Amino Acid sequence : | |||
| SHTLTLRSIAGGRNGVFRSYQKQFPPTPQFRRIHLAFSIHRRSPDQKSKVLRGGGASPGRSERRRCGGDFDGAETESAEFLGGEAGDADSGYDQLSESHEESERGGTGEIGG* | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,064.907 | ||
| Theoretical pI: | 6.887 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 84.361 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.991 | ||
Secondary Structure Fraction | |||
| Helix | 0.179 | ||
| turn | 0.339 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342565.1 | internal | 250 | 3-752(+) |
Amino Acid sequence : | |||
| HTHSLSDPSQEAEMAYSGAIRSSFLPLLNSDEFTSLSRSTAALPIRNQKFCVGAVLHQDGANDVVAGEISTARKPRALSFSGEKPATPILDTINYPNHMKNLSVEELERLADELREEIVY TVSKTGGHLSSSLGVSELTVALHHVFNTPDDKIIWDVGHQAYPHKILTGRRSRMHTIRQTFGLAGFPKRDESPHDAFGAGHSSTSISAGLGMAVGRDLLKKNNHVISVIGDGAMTAGQAY EALNNAGYLD | |||
Physicochemical properties | |||
| Number of amino acids: | 250 | ||
| Molecular weight: | 12,064.907 | ||
| Theoretical pI: | 6.887 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 84.361 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.991 | ||
Secondary Structure Fraction | |||
| Helix | 0.179 | ||
| turn | 0.339 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342565.1 | complete | 153 | 479-18(-) |
Amino Acid sequence : | |||
| MSDIPNDFIIRRVEHVMKCNSELRYAQARAQMPSRFRHRVHNLLPQFIRQSLQFLHAQILHVIRIVDRIQNRRRRLLPRETQRSRFPRRRNLPRNDVVRSVLVKHRPHAKLLISDRESGG GSRKRGEFVGIEEWEETASDSSGIRHFCLLRWI* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 12,064.907 | ||
| Theoretical pI: | 6.887 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 84.361 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.991 | ||
Secondary Structure Fraction | |||
| Helix | 0.179 | ||
| turn | 0.339 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342565.1 | 5prime_partial | 112 | 2-340(+) |
Amino Acid sequence : | |||
| SHTLTLRSIAGGRNGVFRSYQKQFPPTPQFRRIHLAFSIHRRSPDQKSKVLRGGGASPGRSERRRCGGDFDGAETESAEFLGGEAGDADSGYDQLSESHEESERGGTGEIGG* | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,064.907 | ||
| Theoretical pI: | 6.887 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 84.361 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.991 | ||
Secondary Structure Fraction | |||
| Helix | 0.179 | ||
| turn | 0.339 | ||
| sheet | 0.205 | ||