| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342569.1 | internal | 243 | 1-729(+) |
Amino Acid sequence : | |||
| APVKAGVDIWQYVFALPPMAAVKCAVDLQIADILEGHGGAMSLSELSSATGCSPSSLRRIMRYLIHRGFFKQEESTSSISYAQTPLSRLLLQQGDESMAAYFLLQNSPVLLDGWVKLSSR TLTNQTPDSSDEFWEYASKNPTFSKVFNEAMACHARQAVSQILGGCPEVFEGIGSLVDVGGGDGTAIRSIVKGCPWIRGINFDLPHVASAAPPLHGVQHVGGDMFKEVPKADAVFIMWVL HDW | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 18,536.917 | ||
| Theoretical pI: | 10.489 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 60.572 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.471 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.242 | ||
| sheet | 0.261 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342569.1 | 5prime_partial | 165 | 729-232(-) |
Amino Acid sequence : | |||
| PVMQHPHDENSVSLGNLFEHVPSYMLNAVEGRRCRRNVREIEINPANPGATLHDGAYSRAIAAANIHQTTNPLKNLWTTTQDLRHGLPSVARHGLVEHFAERWILRRVFPKLIGGVGSLI GEGARAQLHPPIQQHRAVLQQKIRRHAFISLLEEQTRKRSLGVGD* | |||
Physicochemical properties | |||
| Number of amino acids: | 165 | ||
| Molecular weight: | 18,536.917 | ||
| Theoretical pI: | 10.489 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 60.572 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.471 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.242 | ||
| sheet | 0.261 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342569.1 | internal | 243 | 1-729(+) |
Amino Acid sequence : | |||
| APVKAGVDIWQYVFALPPMAAVKCAVDLQIADILEGHGGAMSLSELSSATGCSPSSLRRIMRYLIHRGFFKQEESTSSISYAQTPLSRLLLQQGDESMAAYFLLQNSPVLLDGWVKLSSR TLTNQTPDSSDEFWEYASKNPTFSKVFNEAMACHARQAVSQILGGCPEVFEGIGSLVDVGGGDGTAIRSIVKGCPWIRGINFDLPHVASAAPPLHGVQHVGGDMFKEVPKADAVFIMWVL HDW | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 18,536.917 | ||
| Theoretical pI: | 10.489 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 60.572 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.471 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.242 | ||
| sheet | 0.261 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342569.1 | 5prime_partial | 165 | 729-232(-) |
Amino Acid sequence : | |||
| PVMQHPHDENSVSLGNLFEHVPSYMLNAVEGRRCRRNVREIEINPANPGATLHDGAYSRAIAAANIHQTTNPLKNLWTTTQDLRHGLPSVARHGLVEHFAERWILRRVFPKLIGGVGSLI GEGARAQLHPPIQQHRAVLQQKIRRHAFISLLEEQTRKRSLGVGD* | |||
Physicochemical properties | |||
| Number of amino acids: | 165 | ||
| Molecular weight: | 18,536.917 | ||
| Theoretical pI: | 10.489 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 60.572 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.471 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.242 | ||
| sheet | 0.261 | ||