| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342570.1 | 5prime_partial | 229 | 762-73(-) |
Amino Acid sequence : | |||
| PVLLDGWVKLSSRTLTNQTPDSSDEFWEYASKNPTFSKVFNEAMACHARQAVSQILGGCPEVFEGIGSLVDVGGGDGTAIRSIVKGCPWIRGINFDLPHVASAAPPLHGVQHVGGDMFKE VPKADAVFIMWVLHDWGDEECIEILKKCKEAVPKETGKVIIAEAVIGEGEGDKYINGIRLSLDMVMLAHTDTGRERTIEEWKYVLNGTGFSSYPVKDIDSIISIIEAHP* | |||
Physicochemical properties | |||
| Number of amino acids: | 229 | ||
| Molecular weight: | 15,008.843 | ||
| Theoretical pI: | 9.987 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 52.937 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.494 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.261 | ||
| sheet | 0.261 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342570.1 | 3prime_partial | 134 | 361-762(+) |
Amino Acid sequence : | |||
| MQHPHDENSVSLGNLFEHVPSYMLNAVEGRRCRRNVREIEINPANPGATLHDGAYSRAIAAANIHQTTNPLKNLWTTTQDLRHGLPSVARHGLVEHFAERWILRRVFPKLIGGVGSLIGE GARAQLHPPIQQHR | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 15,008.843 | ||
| Theoretical pI: | 9.987 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 52.937 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.494 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.261 | ||
| sheet | 0.261 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342570.1 | 5prime_partial | 229 | 762-73(-) |
Amino Acid sequence : | |||
| PVLLDGWVKLSSRTLTNQTPDSSDEFWEYASKNPTFSKVFNEAMACHARQAVSQILGGCPEVFEGIGSLVDVGGGDGTAIRSIVKGCPWIRGINFDLPHVASAAPPLHGVQHVGGDMFKE VPKADAVFIMWVLHDWGDEECIEILKKCKEAVPKETGKVIIAEAVIGEGEGDKYINGIRLSLDMVMLAHTDTGRERTIEEWKYVLNGTGFSSYPVKDIDSIISIIEAHP* | |||
Physicochemical properties | |||
| Number of amino acids: | 229 | ||
| Molecular weight: | 15,008.843 | ||
| Theoretical pI: | 9.987 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 52.937 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.494 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.261 | ||
| sheet | 0.261 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342570.1 | 3prime_partial | 134 | 361-762(+) |
Amino Acid sequence : | |||
| MQHPHDENSVSLGNLFEHVPSYMLNAVEGRRCRRNVREIEINPANPGATLHDGAYSRAIAAANIHQTTNPLKNLWTTTQDLRHGLPSVARHGLVEHFAERWILRRVFPKLIGGVGSLIGE GARAQLHPPIQQHR | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 15,008.843 | ||
| Theoretical pI: | 9.987 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 52.937 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.494 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.261 | ||
| sheet | 0.261 | ||