| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342574.1 | complete | 213 | 42-683(+) |
Amino Acid sequence : | |||
| MATISKLSTAAFANSATSFPRSSHHHSMCCLHPRKTIAISSSQLTIRASPRITSSLDVRCSQVDGNGSSVKRTTLHDLYEKEGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIFQKAI STSSAYNDQFRELVQSGKDIESAYWELVVKDIQDACKLFEPIYYETDGGDGYVSVEVSPRLADDTENTIEAAKWLHRWVNRPNVYIKIPATAA* | |||
Physicochemical properties | |||
| Number of amino acids: | 213 | ||
| Molecular weight: | 23,598.222 | ||
| Theoretical pI: | 6.297 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 34170 | ||
| Instability index: | 44.398 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.343 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.254 | ||
| sheet | 0.211 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342574.1 | complete | 213 | 42-683(+) |
Amino Acid sequence : | |||
| MATISKLSTAAFANSATSFPRSSHHHSMCCLHPRKTIAISSSQLTIRASPRITSSLDVRCSQVDGNGSSVKRTTLHDLYEKEGQSPWYDNLCRPVTDLIPLIESGVRGVTSNPAIFQKAI STSSAYNDQFRELVQSGKDIESAYWELVVKDIQDACKLFEPIYYETDGGDGYVSVEVSPRLADDTENTIEAAKWLHRWVNRPNVYIKIPATAA* | |||
Physicochemical properties | |||
| Number of amino acids: | 213 | ||
| Molecular weight: | 23,598.222 | ||
| Theoretical pI: | 6.297 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 34170 | ||
| Instability index: | 44.398 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.343 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.254 | ||
| sheet | 0.211 | ||