| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342589.1 | internal | 237 | 1-711(+) |
Amino Acid sequence : | |||
| YPHNLLTGRRSRMHTIRQTFGLAGFPKRDESPHDAFGAGHSSTSISAGLGMAVGRDLLKKNNHVISVIGDGAMTAGQAYEALNNAGYLDSNLIIVLNDNKQVSLPTATVDGPAPPVGALS KALTKLQASRKFRQLREAAKGMTKQMGNQAHEIASKVDTYVKGMMGKPGASLFEELGIYYIGPVDGHSVEDLVYIFKKVKEMPAPGPVLIHIITEKGKGYPPAEVAADKMHGVVKFD | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 16,467.867 | ||
| Theoretical pI: | 11.679 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 99.725 | ||
| aromaticity | 0.049 | ||
| GRAVY | -1.601 | ||
Secondary Structure Fraction | |||
| Helix | 0.141 | ||
| turn | 0.275 | ||
| sheet | 0.162 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342589.1 | 5prime_partial | 142 | 3-431(+) |
Amino Acid sequence : | |||
| PTQPFDRKEVKNAHDPADFRASRVPEEGREPARRVRSRPQFHQHFSRSRHGGGARLTKEEQPRHIGDRRWRHDGRTSLRSIEQRRLSRFQSHHSLKRQQTGVVAHSHRRWPRPSGGSLEQ GPHQTAGQQEIPATPRSSEGHD* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 16,467.867 | ||
| Theoretical pI: | 11.679 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 99.725 | ||
| aromaticity | 0.049 | ||
| GRAVY | -1.601 | ||
Secondary Structure Fraction | |||
| Helix | 0.141 | ||
| turn | 0.275 | ||
| sheet | 0.162 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342589.1 | internal | 237 | 1-711(+) |
Amino Acid sequence : | |||
| YPHNLLTGRRSRMHTIRQTFGLAGFPKRDESPHDAFGAGHSSTSISAGLGMAVGRDLLKKNNHVISVIGDGAMTAGQAYEALNNAGYLDSNLIIVLNDNKQVSLPTATVDGPAPPVGALS KALTKLQASRKFRQLREAAKGMTKQMGNQAHEIASKVDTYVKGMMGKPGASLFEELGIYYIGPVDGHSVEDLVYIFKKVKEMPAPGPVLIHIITEKGKGYPPAEVAADKMHGVVKFD | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 16,467.867 | ||
| Theoretical pI: | 11.679 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 99.725 | ||
| aromaticity | 0.049 | ||
| GRAVY | -1.601 | ||
Secondary Structure Fraction | |||
| Helix | 0.141 | ||
| turn | 0.275 | ||
| sheet | 0.162 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342589.1 | 5prime_partial | 142 | 3-431(+) |
Amino Acid sequence : | |||
| PTQPFDRKEVKNAHDPADFRASRVPEEGREPARRVRSRPQFHQHFSRSRHGGGARLTKEEQPRHIGDRRWRHDGRTSLRSIEQRRLSRFQSHHSLKRQQTGVVAHSHRRWPRPSGGSLEQ GPHQTAGQQEIPATPRSSEGHD* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 16,467.867 | ||
| Theoretical pI: | 11.679 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 99.725 | ||
| aromaticity | 0.049 | ||
| GRAVY | -1.601 | ||
Secondary Structure Fraction | |||
| Helix | 0.141 | ||
| turn | 0.275 | ||
| sheet | 0.162 | ||