| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342641.1 | internal | 255 | 3-767(+) |
Amino Acid sequence : | |||
| TRFLCRSSALTHTQRAKMDPVSEWGNSSLSAVDPEIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTRWGVNVQP YSGSPANFAAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESLPYKVDSKTGYIDYERLEEKALDFRPKLIICGGSAYPRDWDYKRFREIADKEAADPFEYCDIVTTTT HKSLRGPRAGMIFYR | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 14,699.623 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 66.814 | ||
| aromaticity | 0.016 | ||
| GRAVY | -1.253 | ||
Secondary Structure Fraction | |||
| Helix | 0.190 | ||
| turn | 0.270 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342641.1 | 5prime_partial | 201 | 1-606(+) |
Amino Acid sequence : | |||
| ARGFSVALPHSHTHRERKWIQSQSGATPRSPPWTPRSTTSSRRRSAANAAASSSSPPRTSPPSPSSRPSAAPSPTSTPRACRATATTVATNSSTRSRISRAHAPSRPTASTPLAGASTSS PTAALRLTSPPTPPSSTPMTASWASICPPAATSPTDTTHPGGRRSVRPRFISRACLIRWIRRLDTSITSDWRRRRWISALN* | |||
Physicochemical properties | |||
| Number of amino acids: | 201 | ||
| Molecular weight: | 14,699.623 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 66.814 | ||
| aromaticity | 0.016 | ||
| GRAVY | -1.253 | ||
Secondary Structure Fraction | |||
| Helix | 0.190 | ||
| turn | 0.270 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342641.1 | 5prime_partial | 154 | 767-303(-) |
Amino Acid sequence : | |||
| TVEDHASSRTPQALVGCCCDDVAVLERIGCFLISDLPKPLIIPIPRVRAPATYNQFRAEIQRLLLQSLVIDVSSLRIHLIRQALEINRGRTDLLPPGCVVSVGEVAAGGQIEAHDAVMGV EDGGVGGEVSRRAAVGLDVDAPASGVEAVGLEGA* | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 14,699.623 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 66.814 | ||
| aromaticity | 0.016 | ||
| GRAVY | -1.253 | ||
Secondary Structure Fraction | |||
| Helix | 0.190 | ||
| turn | 0.270 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342641.1 | 5prime_partial | 126 | 2-382(+) |
Amino Acid sequence : | |||
| HAVSLSLFRTHTHTESENGSSLRVGQLLALRRGPRDPRPHREGEAPPMPRHRAHRLRELHLLRRHRGPRQRPHQQVLRGHAGQPLLRWQRIHRRDRESHALTRPPGLPPRPHSLGRQRPA LQRLSG* | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 14,699.623 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 66.814 | ||
| aromaticity | 0.016 | ||
| GRAVY | -1.253 | ||
Secondary Structure Fraction | |||
| Helix | 0.190 | ||
| turn | 0.270 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342641.1 | internal | 255 | 3-767(+) |
Amino Acid sequence : | |||
| TRFLCRSSALTHTQRAKMDPVSEWGNSSLSAVDPEIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTRWGVNVQP YSGSPANFAAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESLPYKVDSKTGYIDYERLEEKALDFRPKLIICGGSAYPRDWDYKRFREIADKEAADPFEYCDIVTTTT HKSLRGPRAGMIFYR | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 14,699.623 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 66.814 | ||
| aromaticity | 0.016 | ||
| GRAVY | -1.253 | ||
Secondary Structure Fraction | |||
| Helix | 0.190 | ||
| turn | 0.270 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342641.1 | 5prime_partial | 201 | 1-606(+) |
Amino Acid sequence : | |||
| ARGFSVALPHSHTHRERKWIQSQSGATPRSPPWTPRSTTSSRRRSAANAAASSSSPPRTSPPSPSSRPSAAPSPTSTPRACRATATTVATNSSTRSRISRAHAPSRPTASTPLAGASTSS PTAALRLTSPPTPPSSTPMTASWASICPPAATSPTDTTHPGGRRSVRPRFISRACLIRWIRRLDTSITSDWRRRRWISALN* | |||
Physicochemical properties | |||
| Number of amino acids: | 201 | ||
| Molecular weight: | 14,699.623 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 66.814 | ||
| aromaticity | 0.016 | ||
| GRAVY | -1.253 | ||
Secondary Structure Fraction | |||
| Helix | 0.190 | ||
| turn | 0.270 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342641.1 | 5prime_partial | 154 | 767-303(-) |
Amino Acid sequence : | |||
| TVEDHASSRTPQALVGCCCDDVAVLERIGCFLISDLPKPLIIPIPRVRAPATYNQFRAEIQRLLLQSLVIDVSSLRIHLIRQALEINRGRTDLLPPGCVVSVGEVAAGGQIEAHDAVMGV EDGGVGGEVSRRAAVGLDVDAPASGVEAVGLEGA* | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 14,699.623 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 66.814 | ||
| aromaticity | 0.016 | ||
| GRAVY | -1.253 | ||
Secondary Structure Fraction | |||
| Helix | 0.190 | ||
| turn | 0.270 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342641.1 | 5prime_partial | 126 | 2-382(+) |
Amino Acid sequence : | |||
| HAVSLSLFRTHTHTESENGSSLRVGQLLALRRGPRDPRPHREGEAPPMPRHRAHRLRELHLLRRHRGPRQRPHQQVLRGHAGQPLLRWQRIHRRDRESHALTRPPGLPPRPHSLGRQRPA LQRLSG* | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 14,699.623 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 66.814 | ||
| aromaticity | 0.016 | ||
| GRAVY | -1.253 | ||
Secondary Structure Fraction | |||
| Helix | 0.190 | ||
| turn | 0.270 | ||
| sheet | 0.254 | ||