| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342644.1 | internal | 220 | 2-661(+) |
Amino Acid sequence : | |||
| NSXSSVYTLIAFSSLLYFYLIWSESAKPKTTTHKAPPEASGAWPVIGHLRIMSGHPSAGIPHVNLGMLADKHGPIFSIRLGVHRVVVVSSPEVIKELFTTNDVAVSSRPSVKAGKHLAYD NAMLGFASYGAYWRQLRKIVSLELLSNRRLELQSHVSMSETGQFVKELYKLWEKKKSDGSGTEVGEGVVVDMKRWLGELNMNVVMRMVAGKRFGSGDNAE | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 24,160.572 | ||
| Theoretical pI: | 9.571 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37930 37930 | ||
| Instability index: | 40.155 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.116 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.279 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342644.1 | internal | 220 | 2-661(+) |
Amino Acid sequence : | |||
| NSXSSVYTLIAFSSLLYFYLIWSESAKPKTTTHKAPPEASGAWPVIGHLRIMSGHPSAGIPHVNLGMLADKHGPIFSIRLGVHRVVVVSSPEVIKELFTTNDVAVSSRPSVKAGKHLAYD NAMLGFASYGAYWRQLRKIVSLELLSNRRLELQSHVSMSETGQFVKELYKLWEKKKSDGSGTEVGEGVVVDMKRWLGELNMNVVMRMVAGKRFGSGDNAE | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 24,160.572 | ||
| Theoretical pI: | 9.571 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37930 37930 | ||
| Instability index: | 40.155 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.116 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.279 | ||
| sheet | 0.260 | ||