| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342648.1 | internal | 252 | 1-756(+) |
Amino Acid sequence : | |||
| APVRNSNRVALDMARRIKYAVLAPWVVHTTYSYMVKDESERDVGALIIFPFLLTRILHNQLWISYSRYRTAKGTSRIVDKNIEFDQVDREKNWDDQIIFNGLLFYLGYSYIKEAHHLPFW RTDGVIWTILLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFGEHIAYFALFAIPLLTTIWTRTASMTSFAGYITYIDFMNNMGHCNFEHIPKRLFSIFPPLKYLI YTPSYHSLHHTQ | |||
Physicochemical properties | |||
| Number of amino acids: | 252 | ||
| Molecular weight: | 14,449.520 | ||
| Theoretical pI: | 10.356 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 69.901 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.415 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.294 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342648.1 | 3prime_partial | 126 | 378-755(+) |
Amino Acid sequence : | |||
| MDNFASCWSSRVPLLLAPPRPPPPLPLLPLPFPPPLLHRHRAHYVGDPSLRRTHSILRPLRDPVTDNDMDSNGFDDLVRRLYNLHRFHEQHGPLQLRAHSKTTFLHLPSLKISHLHTFIS LAAPHS | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 14,449.520 | ||
| Theoretical pI: | 10.356 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 69.901 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.415 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.294 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342648.1 | internal | 252 | 1-756(+) |
Amino Acid sequence : | |||
| APVRNSNRVALDMARRIKYAVLAPWVVHTTYSYMVKDESERDVGALIIFPFLLTRILHNQLWISYSRYRTAKGTSRIVDKNIEFDQVDREKNWDDQIIFNGLLFYLGYSYIKEAHHLPFW RTDGVIWTILLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSVIHPFGEHIAYFALFAIPLLTTIWTRTASMTSFAGYITYIDFMNNMGHCNFEHIPKRLFSIFPPLKYLI YTPSYHSLHHTQ | |||
Physicochemical properties | |||
| Number of amino acids: | 252 | ||
| Molecular weight: | 14,449.520 | ||
| Theoretical pI: | 10.356 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 69.901 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.415 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.294 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342648.1 | 3prime_partial | 126 | 378-755(+) |
Amino Acid sequence : | |||
| MDNFASCWSSRVPLLLAPPRPPPPLPLLPLPFPPPLLHRHRAHYVGDPSLRRTHSILRPLRDPVTDNDMDSNGFDDLVRRLYNLHRFHEQHGPLQLRAHSKTTFLHLPSLKISHLHTFIS LAAPHS | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 14,449.520 | ||
| Theoretical pI: | 10.356 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 69.901 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.415 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.294 | ||
| sheet | 0.246 | ||