| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342657.1 | internal | 182 | 2-547(+) |
Amino Acid sequence : | |||
| GVENPFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTTLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLF AGVVDGRNIWANDLAASITALHALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDHEIQILA | |||
Physicochemical properties | |||
| Number of amino acids: | 182 | ||
| Molecular weight: | 19,537.075 | ||
| Theoretical pI: | 4.528 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
| Instability index: | 24.035 | ||
| aromaticity | 0.088 | ||
| GRAVY | 0.295 | ||
Secondary Structure Fraction | |||
| Helix | 0.379 | ||
| turn | 0.220 | ||
| sheet | 0.319 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342657.1 | internal | 182 | 2-547(+) |
Amino Acid sequence : | |||
| GVENPFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTTLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLF AGVVDGRNIWANDLAASITALHALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDHEIQILA | |||
Physicochemical properties | |||
| Number of amino acids: | 182 | ||
| Molecular weight: | 19,537.075 | ||
| Theoretical pI: | 4.528 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
| Instability index: | 24.035 | ||
| aromaticity | 0.088 | ||
| GRAVY | 0.295 | ||
Secondary Structure Fraction | |||
| Helix | 0.379 | ||
| turn | 0.220 | ||
| sheet | 0.319 | ||