| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342658.1 | internal | 246 | 1-738(+) |
Amino Acid sequence : | |||
| LLPNSARGGVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTTLSGISGYGFDLVRGAQTIDLIKGG FPSGKYLFAGVVDGRNIWANDLAASITALHALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIVEVNALAKALAGHKDEAFFSANAAAQASRKSSPRVNNEAVQKA APALRG | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 26,189.571 | ||
| Theoretical pI: | 5.468 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
| Instability index: | 26.637 | ||
| aromaticity | 0.081 | ||
| GRAVY | 0.138 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.224 | ||
| sheet | 0.337 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342658.1 | internal | 246 | 1-738(+) |
Amino Acid sequence : | |||
| LLPNSARGGVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTTLSGISGYGFDLVRGAQTIDLIKGG FPSGKYLFAGVVDGRNIWANDLAASITALHALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIVEVNALAKALAGHKDEAFFSANAAAQASRKSSPRVNNEAVQKA APALRG | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 26,189.571 | ||
| Theoretical pI: | 5.468 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
| Instability index: | 26.637 | ||
| aromaticity | 0.081 | ||
| GRAVY | 0.138 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.224 | ||
| sheet | 0.337 | ||