Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342659.1 | internal | 237 | 2-712(+) |
Amino Acid sequence : | |||
GVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTTLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLF AGVVDGRNIWANDLAASITALHALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIVEVNALAKALAGHKDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALR | |||
Physicochemical properties | |||
Number of amino acids: | 237 | ||
Molecular weight: | 25,297.557 | ||
Theoretical pI: | 5.286 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
Instability index: | 25.027 | ||
aromaticity | 0.084 | ||
GRAVY | 0.165 | ||
Secondary Structure Fraction | |||
Helix | 0.338 | ||
turn | 0.207 | ||
sheet | 0.342 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342659.1 | internal | 237 | 2-712(+) |
Amino Acid sequence : | |||
GVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTTLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLF AGVVDGRNIWANDLAASITALHALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIVEVNALAKALAGHKDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALR | |||
Physicochemical properties | |||
Number of amino acids: | 237 | ||
Molecular weight: | 25,297.557 | ||
Theoretical pI: | 5.286 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
Instability index: | 25.027 | ||
aromaticity | 0.084 | ||
GRAVY | 0.165 | ||
Secondary Structure Fraction | |||
Helix | 0.338 | ||
turn | 0.207 | ||
sheet | 0.342 |