| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342663.1 | 5prime_partial | 212 | 2-640(+) |
Amino Acid sequence : | |||
| HAVSCRIRHEGLSDKMPGVIDVLVKNGRQIDAVNLAFAFELTDQFSPISLLKSYLSEAKKLPSPTKSGNTSPGVSTHNDVNEKELTALKAVIKCVEDHKLEEQLPLDPLQKQVLEIEKAK ADKKRATEVAKPQSKRPRANGVAHAPRVDKNFYGRMPERYPQQYAYDRPPYAYVGPNDHHVPSYVATAAYNFSPSHGSFFGNGYQYHTTYLH* | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 14,676.251 | ||
| Theoretical pI: | 8.317 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29365 | ||
| Instability index: | 49.003 | ||
| aromaticity | 0.128 | ||
| GRAVY | 0.556 | ||
Secondary Structure Fraction | |||
| Helix | 0.456 | ||
| turn | 0.160 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342663.1 | complete | 125 | 589-212(-) |
Amino Acid sequence : | |||
| MTGGEIIRCSGDVRWDVVVVRAHISIRWPVIGVLLWVPLRHSTIEVLVNTRSMSNAVGTGSFRLWFRNFCRPFLVCLCFLDLEHLFLEWVQRELLLKLVIFYAFDHSFECRELFLVHVVM CGHTR* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 14,676.251 | ||
| Theoretical pI: | 8.317 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29365 | ||
| Instability index: | 49.003 | ||
| aromaticity | 0.128 | ||
| GRAVY | 0.556 | ||
Secondary Structure Fraction | |||
| Helix | 0.456 | ||
| turn | 0.160 | ||
| sheet | 0.240 | ||