| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342665.1 | internal | 227 | 2-682(+) |
Amino Acid sequence : | |||
| NKRKFQTSSQLHTRRCTRQQFSDMAMASSLPSPLTIKTSLKQPDVKLPGVGPCAARSLPLPSLKLTARPSSSSVPVVVAAATSMVGAETQAGAATPAKVLPFRVGHGFDLHRLEPGYPLI IGGINIPHDRGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDTDPKWKGAPSSVFMEEAVRLMHEAGYELGNLDATLILQRPKVSPHKEAIRANLCKLLGADPSV | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 24,117.640 | ||
| Theoretical pI: | 8.860 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 47.154 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.063 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.273 | ||
| sheet | 0.273 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342665.1 | internal | 227 | 2-682(+) |
Amino Acid sequence : | |||
| NKRKFQTSSQLHTRRCTRQQFSDMAMASSLPSPLTIKTSLKQPDVKLPGVGPCAARSLPLPSLKLTARPSSSSVPVVVAAATSMVGAETQAGAATPAKVLPFRVGHGFDLHRLEPGYPLI IGGINIPHDRGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDTDPKWKGAPSSVFMEEAVRLMHEAGYELGNLDATLILQRPKVSPHKEAIRANLCKLLGADPSV | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 24,117.640 | ||
| Theoretical pI: | 8.860 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 47.154 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.063 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.273 | ||
| sheet | 0.273 | ||