| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342675.1 | 5prime_partial | 127 | 1-384(+) |
Amino Acid sequence : | |||
| KNLEVAKMVQRLTYRTRHSYATKSNKHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLPRNERTVNRPYGGVLSGTAVRERIIRAFLVEEQKIVKKVLKIQKAK EKLASRS* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 14,559.018 | ||
| Theoretical pI: | 11.358 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
| Instability index: | 39.775 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.843 | ||
Secondary Structure Fraction | |||
| Helix | 0.260 | ||
| turn | 0.205 | ||
| sheet | 0.197 | ||