| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342686.1 | internal | 191 | 2-574(+) |
Amino Acid sequence : | |||
| QAHGACLRRRRWRFPTSMENHGGPMTLSELSAASGCPREPLYRLLRCLIFHGIVTKSDDCYAQSPLSRLFTTENLGPYMLMQATPVTRCPTGLNGKPLKTGTRLYLKSIIGEDSWSDPDY CYHMKAFTNAMTAHARLTVAAIERNYPAAFDGVQSVVDVGSRHRTAIGKLVEAFPWVRGIAFDLPEIVADA | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 12,353.674 | ||
| Theoretical pI: | 7.056 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 68.442 | ||
| aromaticity | 0.018 | ||
| GRAVY | -0.835 | ||
Secondary Structure Fraction | |||
| Helix | 0.198 | ||
| turn | 0.270 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342686.1 | 5prime_partial | 111 | 1-336(+) |
Amino Acid sequence : | |||
| SSPRRMSAAEEVEIPDIHGKSRRPDDAVGALRRLRLPPRAALPPPEMPHLPRHRHQIRRLLRPIAAFSAFHDRESGALHVDAGNAGNEVSDGLERQTLENGDEALSEVNHR* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,353.674 | ||
| Theoretical pI: | 7.056 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 68.442 | ||
| aromaticity | 0.018 | ||
| GRAVY | -0.835 | ||
Secondary Structure Fraction | |||
| Helix | 0.198 | ||
| turn | 0.270 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342686.1 | internal | 191 | 2-574(+) |
Amino Acid sequence : | |||
| QAHGACLRRRRWRFPTSMENHGGPMTLSELSAASGCPREPLYRLLRCLIFHGIVTKSDDCYAQSPLSRLFTTENLGPYMLMQATPVTRCPTGLNGKPLKTGTRLYLKSIIGEDSWSDPDY CYHMKAFTNAMTAHARLTVAAIERNYPAAFDGVQSVVDVGSRHRTAIGKLVEAFPWVRGIAFDLPEIVADA | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 12,353.674 | ||
| Theoretical pI: | 7.056 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 68.442 | ||
| aromaticity | 0.018 | ||
| GRAVY | -0.835 | ||
Secondary Structure Fraction | |||
| Helix | 0.198 | ||
| turn | 0.270 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342686.1 | 5prime_partial | 111 | 1-336(+) |
Amino Acid sequence : | |||
| SSPRRMSAAEEVEIPDIHGKSRRPDDAVGALRRLRLPPRAALPPPEMPHLPRHRHQIRRLLRPIAAFSAFHDRESGALHVDAGNAGNEVSDGLERQTLENGDEALSEVNHR* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,353.674 | ||
| Theoretical pI: | 7.056 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 68.442 | ||
| aromaticity | 0.018 | ||
| GRAVY | -0.835 | ||
Secondary Structure Fraction | |||
| Helix | 0.198 | ||
| turn | 0.270 | ||
| sheet | 0.324 | ||