Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342687.1 | 5prime_partial | 239 | 750-31(-) |
Amino Acid sequence : | |||
EAQLHAQAWAHALSYIKPTALSAAVELEIPDILENHGGPMTLSELSAASGCPREPLYRLMRFLIFHGIVTKSDDCYAQSPLSRLFTTENLGPYMLMQATPVTRCPTGLSGEALKTGTSLY LKSIRGEDSWSDPAYGYHMKAFTNAMTAHARLTAAAIVRNYPAAFDGVQSVVDVGSRPGTAIGKLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMVSFFILS* | |||
Physicochemical properties | |||
Number of amino acids: | 239 | ||
Molecular weight: | 13,526.001 | ||
Theoretical pI: | 10.600 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 60.118 | ||
aromaticity | 0.016 | ||
GRAVY | -0.854 | ||
Secondary Structure Fraction | |||
Helix | 0.176 | ||
turn | 0.312 | ||
sheet | 0.256 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342687.1 | 5prime_partial | 125 | 748-371(-) |
Amino Acid sequence : | |||
SPTSCTSMGPRPKLHQAHGAVCGGGAGDSRHPGKSRRPDDAVGALRRLRLPPRAALPPHEIPHLPRHRHQIRRLLRPVAAFSAFHDRESGALHVDAGDAGNEVSDGLERRSLENGDKPLS EVNQR* | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 13,526.001 | ||
Theoretical pI: | 10.600 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 60.118 | ||
aromaticity | 0.016 | ||
GRAVY | -0.854 | ||
Secondary Structure Fraction | |||
Helix | 0.176 | ||
turn | 0.312 | ||
sheet | 0.256 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342687.1 | 5prime_partial | 239 | 750-31(-) |
Amino Acid sequence : | |||
EAQLHAQAWAHALSYIKPTALSAAVELEIPDILENHGGPMTLSELSAASGCPREPLYRLMRFLIFHGIVTKSDDCYAQSPLSRLFTTENLGPYMLMQATPVTRCPTGLSGEALKTGTSLY LKSIRGEDSWSDPAYGYHMKAFTNAMTAHARLTAAAIVRNYPAAFDGVQSVVDVGSRPGTAIGKLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMVSFFILS* | |||
Physicochemical properties | |||
Number of amino acids: | 239 | ||
Molecular weight: | 13,526.001 | ||
Theoretical pI: | 10.600 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 60.118 | ||
aromaticity | 0.016 | ||
GRAVY | -0.854 | ||
Secondary Structure Fraction | |||
Helix | 0.176 | ||
turn | 0.312 | ||
sheet | 0.256 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342687.1 | 5prime_partial | 125 | 748-371(-) |
Amino Acid sequence : | |||
SPTSCTSMGPRPKLHQAHGAVCGGGAGDSRHPGKSRRPDDAVGALRRLRLPPRAALPPHEIPHLPRHRHQIRRLLRPVAAFSAFHDRESGALHVDAGDAGNEVSDGLERRSLENGDKPLS EVNQR* | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 13,526.001 | ||
Theoretical pI: | 10.600 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 60.118 | ||
aromaticity | 0.016 | ||
GRAVY | -0.854 | ||
Secondary Structure Fraction | |||
Helix | 0.176 | ||
turn | 0.312 | ||
sheet | 0.256 |