| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342688.1 | internal | 248 | 2-745(+) |
Amino Acid sequence : | |||
| GVEKPFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTTLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLF AGVVDGRNIWANDLAASITALHALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIVEVNALAKALAGHKDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALRGSD HPRATNVS | |||
Physicochemical properties | |||
| Number of amino acids: | 248 | ||
| Molecular weight: | 26,415.717 | ||
| Theoretical pI: | 5.432 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
| Instability index: | 22.967 | ||
| aromaticity | 0.081 | ||
| GRAVY | 0.102 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.222 | ||
| sheet | 0.331 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342688.1 | internal | 248 | 2-745(+) |
Amino Acid sequence : | |||
| GVEKPFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTTLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLF AGVVDGRNIWANDLAASITALHALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIVEVNALAKALAGHKDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALRGSD HPRATNVS | |||
Physicochemical properties | |||
| Number of amino acids: | 248 | ||
| Molecular weight: | 26,415.717 | ||
| Theoretical pI: | 5.432 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
| Instability index: | 22.967 | ||
| aromaticity | 0.081 | ||
| GRAVY | 0.102 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.222 | ||
| sheet | 0.331 | ||