| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342689.1 | internal | 240 | 2-721(+) |
Amino Acid sequence : | |||
| GVEKPFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTTLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLF AGVVDGRNIWANDLAASITALHALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIVEVNALAKALAGHKDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALRGSD | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 25,552.784 | ||
| Theoretical pI: | 5.172 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
| Instability index: | 24.459 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.140 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.217 | ||
| sheet | 0.338 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342689.1 | internal | 240 | 2-721(+) |
Amino Acid sequence : | |||
| GVEKPFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTTLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLF AGVVDGRNIWANDLAASITALHALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIVEVNALAKALAGHKDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALRGSD | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 25,552.784 | ||
| Theoretical pI: | 5.172 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
| Instability index: | 24.459 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.140 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.217 | ||
| sheet | 0.338 | ||