| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342690.1 | internal | 252 | 2-757(+) |
Amino Acid sequence : | |||
| GVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTTLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLF AGVVDGRNIWANDLAASITALHALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIVEVNALAKALAGHKDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALRGSD HRRATNVHARLD | |||
Physicochemical properties | |||
| Number of amino acids: | 252 | ||
| Molecular weight: | 26,984.347 | ||
| Theoretical pI: | 5.780 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
| Instability index: | 25.472 | ||
| aromaticity | 0.079 | ||
| GRAVY | 0.073 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.206 | ||
| sheet | 0.333 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342690.1 | internal | 252 | 2-757(+) |
Amino Acid sequence : | |||
| GVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTTLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLF AGVVDGRNIWANDLAASITALHALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIVEVNALAKALAGHKDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALRGSD HRRATNVHARLD | |||
Physicochemical properties | |||
| Number of amino acids: | 252 | ||
| Molecular weight: | 26,984.347 | ||
| Theoretical pI: | 5.780 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
| Instability index: | 25.472 | ||
| aromaticity | 0.079 | ||
| GRAVY | 0.073 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.206 | ||
| sheet | 0.333 | ||