| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342707.1 | internal | 179 | 1-537(+) |
Amino Acid sequence : | |||
| FSMVKQPFPGITIDEERIVSSTGALSLKEVPKRLVVIGAGYIGLEMGSVWGRLGSEVSVVEFGPDIVPTMDGEVRKQFQRSLEKQKMKFILKTKVVSVDTTGSGLKLTLEPAAGGEQSTL EADVVLASAGRVPFTAGLQLDKIGVETDKLGRILVNERFATNAPGVYAIGDVIPGPMLA | |||
Physicochemical properties | |||
| Number of amino acids: | 179 | ||
| Molecular weight: | 10,489.821 | ||
| Theoretical pI: | 8.959 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 37.194 | ||
| aromaticity | 0.080 | ||
| GRAVY | 0.200 | ||
Secondary Structure Fraction | |||
| Helix | 0.280 | ||
| turn | 0.380 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342707.1 | 5prime_partial | 100 | 536-234(-) |
Amino Acid sequence : | |||
| ASIGPGMTSPIAYTPGALVANLSFTRMRPNLSVSTPILSNWSPAVNGTLPAEARTTSASSVDCSPPAAGSSVNFNPLPVVSTETTLVFRINFIFCFSRER* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 10,489.821 | ||
| Theoretical pI: | 8.959 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 37.194 | ||
| aromaticity | 0.080 | ||
| GRAVY | 0.200 | ||
Secondary Structure Fraction | |||
| Helix | 0.280 | ||
| turn | 0.380 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342707.1 | internal | 179 | 1-537(+) |
Amino Acid sequence : | |||
| FSMVKQPFPGITIDEERIVSSTGALSLKEVPKRLVVIGAGYIGLEMGSVWGRLGSEVSVVEFGPDIVPTMDGEVRKQFQRSLEKQKMKFILKTKVVSVDTTGSGLKLTLEPAAGGEQSTL EADVVLASAGRVPFTAGLQLDKIGVETDKLGRILVNERFATNAPGVYAIGDVIPGPMLA | |||
Physicochemical properties | |||
| Number of amino acids: | 179 | ||
| Molecular weight: | 10,489.821 | ||
| Theoretical pI: | 8.959 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 37.194 | ||
| aromaticity | 0.080 | ||
| GRAVY | 0.200 | ||
Secondary Structure Fraction | |||
| Helix | 0.280 | ||
| turn | 0.380 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342707.1 | 5prime_partial | 100 | 536-234(-) |
Amino Acid sequence : | |||
| ASIGPGMTSPIAYTPGALVANLSFTRMRPNLSVSTPILSNWSPAVNGTLPAEARTTSASSVDCSPPAAGSSVNFNPLPVVSTETTLVFRINFIFCFSRER* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 10,489.821 | ||
| Theoretical pI: | 8.959 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 37.194 | ||
| aromaticity | 0.080 | ||
| GRAVY | 0.200 | ||
Secondary Structure Fraction | |||
| Helix | 0.280 | ||
| turn | 0.380 | ||
| sheet | 0.220 | ||