Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342711.1 | internal | 130 | 392-3(-) |
Amino Acid sequence : | |||
QTEILPTKGHSYSEIINQSVIESLDSLTPFMHARGVSFMVDNCLTTARLASRKWAPRFAYILTQQALFAVDNATPINHGLISNFLSDPVHGATEGSAQLRPTVDISVPADADFVRPEPRQ SANRRGGFSS | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 14,197.780 | ||
Theoretical pI: | 6.452 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 52.302 | ||
aromaticity | 0.077 | ||
GRAVY | -0.203 | ||
Secondary Structure Fraction | |||
Helix | 0.277 | ||
turn | 0.277 | ||
sheet | 0.231 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342711.1 | internal | 130 | 392-3(-) |
Amino Acid sequence : | |||
QTEILPTKGHSYSEIINQSVIESLDSLTPFMHARGVSFMVDNCLTTARLASRKWAPRFAYILTQQALFAVDNATPINHGLISNFLSDPVHGATEGSAQLRPTVDISVPADADFVRPEPRQ SANRRGGFSS | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 14,197.780 | ||
Theoretical pI: | 6.452 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 52.302 | ||
aromaticity | 0.077 | ||
GRAVY | -0.203 | ||
Secondary Structure Fraction | |||
Helix | 0.277 | ||
turn | 0.277 | ||
sheet | 0.231 |