Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342713.1 | internal | 239 | 2-718(+) |
Amino Acid sequence : | |||
GVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTTLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLF AGVVDGRNIWANDLAASITALHALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIVEVNALAKALAGHKDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALRGS | |||
Physicochemical properties | |||
Number of amino acids: | 239 | ||
Molecular weight: | 25,441.686 | ||
Theoretical pI: | 5.286 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
Instability index: | 24.546 | ||
aromaticity | 0.084 | ||
GRAVY | 0.159 | ||
Secondary Structure Fraction | |||
Helix | 0.335 | ||
turn | 0.213 | ||
sheet | 0.339 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342713.1 | internal | 239 | 2-718(+) |
Amino Acid sequence : | |||
GVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTTLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLF AGVVDGRNIWANDLAASITALHALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIVEVNALAKALAGHKDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALRGS | |||
Physicochemical properties | |||
Number of amino acids: | 239 | ||
Molecular weight: | 25,441.686 | ||
Theoretical pI: | 5.286 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
Instability index: | 24.546 | ||
aromaticity | 0.084 | ||
GRAVY | 0.159 | ||
Secondary Structure Fraction | |||
Helix | 0.335 | ||
turn | 0.213 | ||
sheet | 0.339 |