| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342717.1 | internal | 249 | 2-748(+) |
Amino Acid sequence : | |||
| GVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTTLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLF AGVVDGRNIWANDLAASITALHALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIVEVNALAKALAGHKDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALRGSD HRRATKCQC | |||
Physicochemical properties | |||
| Number of amino acids: | 249 | ||
| Molecular weight: | 26,641.053 | ||
| Theoretical pI: | 5.858 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
| Instability index: | 25.656 | ||
| aromaticity | 0.080 | ||
| GRAVY | 0.084 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.205 | ||
| sheet | 0.329 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342717.1 | internal | 249 | 2-748(+) |
Amino Acid sequence : | |||
| GVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTTLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLF AGVVDGRNIWANDLAASITALHALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIVEVNALAKALAGHKDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALRGSD HRRATKCQC | |||
Physicochemical properties | |||
| Number of amino acids: | 249 | ||
| Molecular weight: | 26,641.053 | ||
| Theoretical pI: | 5.858 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
| Instability index: | 25.656 | ||
| aromaticity | 0.080 | ||
| GRAVY | 0.084 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.205 | ||
| sheet | 0.329 | ||