Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342718.1 | 5prime_partial | 202 | 3-611(+) |
Amino Acid sequence : | |||
TRFTSTSSSSLSSSSAVVPGSSDELATLIRRDINQIQSLCADMDRLWRSIPSKPQRDLWKRKVEQVSEEAESFRASLDKYMSRHQKRIQEAQERAELLGRASGDTVLRIFDEESQAMESV RRSSRLLEESFATGVAILSKYSEQRDHLKRAQRKALDVLNTLGLSNSVLRLIERRNRFDKWIKYAGMILTIIIVVIFWRWTR* | |||
Physicochemical properties | |||
Number of amino acids: | 202 | ||
Molecular weight: | 23,378.373 | ||
Theoretical pI: | 10.042 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 31970 | ||
Instability index: | 70.121 | ||
aromaticity | 0.069 | ||
GRAVY | -0.500 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.203 | ||
sheet | 0.267 |