| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342718.1 | 5prime_partial | 202 | 3-611(+) |
Amino Acid sequence : | |||
| TRFTSTSSSSLSSSSAVVPGSSDELATLIRRDINQIQSLCADMDRLWRSIPSKPQRDLWKRKVEQVSEEAESFRASLDKYMSRHQKRIQEAQERAELLGRASGDTVLRIFDEESQAMESV RRSSRLLEESFATGVAILSKYSEQRDHLKRAQRKALDVLNTLGLSNSVLRLIERRNRFDKWIKYAGMILTIIIVVIFWRWTR* | |||
Physicochemical properties | |||
| Number of amino acids: | 202 | ||
| Molecular weight: | 23,378.373 | ||
| Theoretical pI: | 10.042 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 31970 | ||
| Instability index: | 70.121 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.500 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.203 | ||
| sheet | 0.267 | ||