| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342725.1 | internal | 245 | 2-736(+) |
Amino Acid sequence : | |||
| PHSPSAEIFSSFMATQPQVITCKAAVAWEPNKPLVIEEVQVAPPQSGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGHEASGIVESVGEGVTDVQPGDHVIPCYQAECGECKFCKSG KTNLCGKVRLATGVGVMLTDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKINPVAPLEKVCLLGCGVPTGLGAVWNTAKVEQGSIVAIFGLGTVGLAVAEGAKAAGASRIIGIDID SKKFD | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 11,979.361 | ||
| Theoretical pI: | 8.934 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 74.257 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.688 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.225 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342725.1 | 3prime_partial | 102 | 307-2(-) |
Amino Acid sequence : | |||
| MITRLNISHTFTNTLNYPRSLMTENTWEETLRILAAPRVGICVTESGEEDFDSDLSGLRRRHLHLLDDQRLIGFPGHRRFASNDLRLSCHEGRENFSRRRVR | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,979.361 | ||
| Theoretical pI: | 8.934 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 74.257 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.688 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.225 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342725.1 | internal | 245 | 2-736(+) |
Amino Acid sequence : | |||
| PHSPSAEIFSSFMATQPQVITCKAAVAWEPNKPLVIEEVQVAPPQSGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGHEASGIVESVGEGVTDVQPGDHVIPCYQAECGECKFCKSG KTNLCGKVRLATGVGVMLTDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKINPVAPLEKVCLLGCGVPTGLGAVWNTAKVEQGSIVAIFGLGTVGLAVAEGAKAAGASRIIGIDID SKKFD | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 11,979.361 | ||
| Theoretical pI: | 8.934 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 74.257 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.688 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.225 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342725.1 | 3prime_partial | 102 | 307-2(-) |
Amino Acid sequence : | |||
| MITRLNISHTFTNTLNYPRSLMTENTWEETLRILAAPRVGICVTESGEEDFDSDLSGLRRRHLHLLDDQRLIGFPGHRRFASNDLRLSCHEGRENFSRRRVR | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,979.361 | ||
| Theoretical pI: | 8.934 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 74.257 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.688 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.225 | ||
| sheet | 0.255 | ||