Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342725.1 | internal | 245 | 2-736(+) |
Amino Acid sequence : | |||
PHSPSAEIFSSFMATQPQVITCKAAVAWEPNKPLVIEEVQVAPPQSGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGHEASGIVESVGEGVTDVQPGDHVIPCYQAECGECKFCKSG KTNLCGKVRLATGVGVMLTDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKINPVAPLEKVCLLGCGVPTGLGAVWNTAKVEQGSIVAIFGLGTVGLAVAEGAKAAGASRIIGIDID SKKFD | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 11,979.361 | ||
Theoretical pI: | 8.934 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 74.257 | ||
aromaticity | 0.069 | ||
GRAVY | -0.688 | ||
Secondary Structure Fraction | |||
Helix | 0.275 | ||
turn | 0.225 | ||
sheet | 0.255 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342725.1 | 3prime_partial | 102 | 307-2(-) |
Amino Acid sequence : | |||
MITRLNISHTFTNTLNYPRSLMTENTWEETLRILAAPRVGICVTESGEEDFDSDLSGLRRRHLHLLDDQRLIGFPGHRRFASNDLRLSCHEGRENFSRRRVR | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,979.361 | ||
Theoretical pI: | 8.934 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 74.257 | ||
aromaticity | 0.069 | ||
GRAVY | -0.688 | ||
Secondary Structure Fraction | |||
Helix | 0.275 | ||
turn | 0.225 | ||
sheet | 0.255 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342725.1 | internal | 245 | 2-736(+) |
Amino Acid sequence : | |||
PHSPSAEIFSSFMATQPQVITCKAAVAWEPNKPLVIEEVQVAPPQSGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGHEASGIVESVGEGVTDVQPGDHVIPCYQAECGECKFCKSG KTNLCGKVRLATGVGVMLTDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKINPVAPLEKVCLLGCGVPTGLGAVWNTAKVEQGSIVAIFGLGTVGLAVAEGAKAAGASRIIGIDID SKKFD | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 11,979.361 | ||
Theoretical pI: | 8.934 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 74.257 | ||
aromaticity | 0.069 | ||
GRAVY | -0.688 | ||
Secondary Structure Fraction | |||
Helix | 0.275 | ||
turn | 0.225 | ||
sheet | 0.255 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342725.1 | 3prime_partial | 102 | 307-2(-) |
Amino Acid sequence : | |||
MITRLNISHTFTNTLNYPRSLMTENTWEETLRILAAPRVGICVTESGEEDFDSDLSGLRRRHLHLLDDQRLIGFPGHRRFASNDLRLSCHEGRENFSRRRVR | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,979.361 | ||
Theoretical pI: | 8.934 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 74.257 | ||
aromaticity | 0.069 | ||
GRAVY | -0.688 | ||
Secondary Structure Fraction | |||
Helix | 0.275 | ||
turn | 0.225 | ||
sheet | 0.255 |