| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342733.1 | 5prime_partial | 214 | 706-62(-) |
Amino Acid sequence : | |||
| PLKPLEMSEPLHLPWLDEQAPESVIYISFGSRTALSKEQITELAAALEATNCVFLWVLKGEKVDKEDKEEIAEMVGEAFLEKTKGKGMVVKGWVDQERILAHPAVGGFVSHCGWNSVTEA AAMGVPVVAWPIHGDQRINAAVVEEMGLGVWERGWLGGRLIGRDEIAEKLEALMGDERLRKKAKMVREKAMEAIERGGNSERTIQGLIQSLQGM* | |||
Physicochemical properties | |||
| Number of amino acids: | 214 | ||
| Molecular weight: | 14,762.957 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 79.893 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.868 | ||
Secondary Structure Fraction | |||
| Helix | 0.268 | ||
| turn | 0.293 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342733.1 | complete | 123 | 38-409(+) |
Amino Acid sequence : | |||
| MQTNFLRISHSLQRLNQPLNRPLRIPASLNSFHRFLSHHLRLLPQPLIPHQSLQLLRNLISSDQPPPQPPPLPHSQSHLLHHRRVYSLISMDRPRHHRNPHRRRLRHRIPTAVAHESPHR WMR* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 14,762.957 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 79.893 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.868 | ||
Secondary Structure Fraction | |||
| Helix | 0.268 | ||
| turn | 0.293 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342733.1 | 5prime_partial | 214 | 706-62(-) |
Amino Acid sequence : | |||
| PLKPLEMSEPLHLPWLDEQAPESVIYISFGSRTALSKEQITELAAALEATNCVFLWVLKGEKVDKEDKEEIAEMVGEAFLEKTKGKGMVVKGWVDQERILAHPAVGGFVSHCGWNSVTEA AAMGVPVVAWPIHGDQRINAAVVEEMGLGVWERGWLGGRLIGRDEIAEKLEALMGDERLRKKAKMVREKAMEAIERGGNSERTIQGLIQSLQGM* | |||
Physicochemical properties | |||
| Number of amino acids: | 214 | ||
| Molecular weight: | 14,762.957 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 79.893 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.868 | ||
Secondary Structure Fraction | |||
| Helix | 0.268 | ||
| turn | 0.293 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342733.1 | complete | 123 | 38-409(+) |
Amino Acid sequence : | |||
| MQTNFLRISHSLQRLNQPLNRPLRIPASLNSFHRFLSHHLRLLPQPLIPHQSLQLLRNLISSDQPPPQPPPLPHSQSHLLHHRRVYSLISMDRPRHHRNPHRRRLRHRIPTAVAHESPHR WMR* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 14,762.957 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 79.893 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.868 | ||
Secondary Structure Fraction | |||
| Helix | 0.268 | ||
| turn | 0.293 | ||
| sheet | 0.220 | ||