| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342747.1 | internal | 266 | 799-2(-) |
Amino Acid sequence : | |||
| TPVILPGSCLSEANLKEVLTFCYQNNLVLLGDEVYQQNIYQDERPFISARKVLMDMGPPMSKEVELVSFHTVSKGYWGECGQRGGYFEMMNISPRTVEEIYKVASIALSPNVPAQIFMGL MMNPLKPGDISYDQFTRESKGILDSLRKRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAI MANVKKFNDEFMEQYKRTEGIQGCDE | |||
Physicochemical properties | |||
| Number of amino acids: | 266 | ||
| Molecular weight: | 29,768.013 | ||
| Theoretical pI: | 5.416 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20400 20775 | ||
| Instability index: | 52.050 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.211 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.248 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342747.1 | internal | 266 | 799-2(-) |
Amino Acid sequence : | |||
| TPVILPGSCLSEANLKEVLTFCYQNNLVLLGDEVYQQNIYQDERPFISARKVLMDMGPPMSKEVELVSFHTVSKGYWGECGQRGGYFEMMNISPRTVEEIYKVASIALSPNVPAQIFMGL MMNPLKPGDISYDQFTRESKGILDSLRKRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKQAGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAI MANVKKFNDEFMEQYKRTEGIQGCDE | |||
Physicochemical properties | |||
| Number of amino acids: | 266 | ||
| Molecular weight: | 29,768.013 | ||
| Theoretical pI: | 5.416 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20400 20775 | ||
| Instability index: | 52.050 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.211 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.248 | ||
| sheet | 0.259 | ||