| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342751.1 | 5prime_partial | 236 | 2-712(+) |
Amino Acid sequence : | |||
| HPVEGKDGSIDKGLLQSTELYKYILDTSVYPREEECLKELRALTWTHPRAVMGTAPETGQFMALLLKTINAKKTLEIGVFTGYSLLLTALAIPHDGKITAIDINRDTYEIGLPIIEKAGV KHKIDFIESKALPALDHLLKDGENKESFDFVFVDADKVNYANYHERVLELLRPGGIVVYDNTLWGGTVAMAPDLVAESKLQYRNAAVEFNNFIAADSRVQISQLPVGDGITVCRRK* | |||
Physicochemical properties | |||
| Number of amino acids: | 236 | ||
| Molecular weight: | 13,984.332 | ||
| Theoretical pI: | 9.584 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
| Instability index: | 32.313 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.009 | ||
Secondary Structure Fraction | |||
| Helix | 0.361 | ||
| turn | 0.193 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342751.1 | 5prime_partial | 119 | 772-413(-) |
Amino Acid sequence : | |||
| KLCCMLRKEWNFHFITTYTLSLAATNSNPITHRELRNLNTRVCSNEVVKLHCSIPVLELALRHQIRRHRNGASPQCVVINNYSTWPQKLQHPFMVVCIVHFISIHKHEVKTLFILPIFE* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,984.332 | ||
| Theoretical pI: | 9.584 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
| Instability index: | 32.313 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.009 | ||
Secondary Structure Fraction | |||
| Helix | 0.361 | ||
| turn | 0.193 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342751.1 | 5prime_partial | 236 | 2-712(+) |
Amino Acid sequence : | |||
| HPVEGKDGSIDKGLLQSTELYKYILDTSVYPREEECLKELRALTWTHPRAVMGTAPETGQFMALLLKTINAKKTLEIGVFTGYSLLLTALAIPHDGKITAIDINRDTYEIGLPIIEKAGV KHKIDFIESKALPALDHLLKDGENKESFDFVFVDADKVNYANYHERVLELLRPGGIVVYDNTLWGGTVAMAPDLVAESKLQYRNAAVEFNNFIAADSRVQISQLPVGDGITVCRRK* | |||
Physicochemical properties | |||
| Number of amino acids: | 236 | ||
| Molecular weight: | 13,984.332 | ||
| Theoretical pI: | 9.584 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
| Instability index: | 32.313 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.009 | ||
Secondary Structure Fraction | |||
| Helix | 0.361 | ||
| turn | 0.193 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342751.1 | 5prime_partial | 119 | 772-413(-) |
Amino Acid sequence : | |||
| KLCCMLRKEWNFHFITTYTLSLAATNSNPITHRELRNLNTRVCSNEVVKLHCSIPVLELALRHQIRRHRNGASPQCVVINNYSTWPQKLQHPFMVVCIVHFISIHKHEVKTLFILPIFE* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,984.332 | ||
| Theoretical pI: | 9.584 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
| Instability index: | 32.313 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.009 | ||
Secondary Structure Fraction | |||
| Helix | 0.361 | ||
| turn | 0.193 | ||
| sheet | 0.210 | ||