| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342755.1 | internal | 268 | 2-805(+) |
Amino Acid sequence : | |||
| TTVYSRSASASRPPLPFSSSIKWEMARKKIREYDSKRLLKEHLKRLSGIDLQIRSAQVTESTDFAELTNKEPWLSSTRLVVKPDMLFGKRGKSGLVALNLDLAQVAAFVKERLGVEVEMG GCKAPITTFIVEPFVPHDQEYYLSIVSERLGNTISFSECGGIEIEENWDKVKTVFLPTEKSMNLEACAPLIATLPLEVRGKIGEFINGVFSVFQDLDFSFLEMNPFTLVNGEPYPLDMRG ELDDTAAFKNFKKWGDIEFPLPFGRVLS | |||
Physicochemical properties | |||
| Number of amino acids: | 268 | ||
| Molecular weight: | 30,153.353 | ||
| Theoretical pI: | 5.480 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29575 | ||
| Instability index: | 39.841 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.159 | ||
Secondary Structure Fraction | |||
| Helix | 0.332 | ||
| turn | 0.239 | ||
| sheet | 0.276 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342755.1 | internal | 268 | 2-805(+) |
Amino Acid sequence : | |||
| TTVYSRSASASRPPLPFSSSIKWEMARKKIREYDSKRLLKEHLKRLSGIDLQIRSAQVTESTDFAELTNKEPWLSSTRLVVKPDMLFGKRGKSGLVALNLDLAQVAAFVKERLGVEVEMG GCKAPITTFIVEPFVPHDQEYYLSIVSERLGNTISFSECGGIEIEENWDKVKTVFLPTEKSMNLEACAPLIATLPLEVRGKIGEFINGVFSVFQDLDFSFLEMNPFTLVNGEPYPLDMRG ELDDTAAFKNFKKWGDIEFPLPFGRVLS | |||
Physicochemical properties | |||
| Number of amino acids: | 268 | ||
| Molecular weight: | 30,153.353 | ||
| Theoretical pI: | 5.480 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29575 | ||
| Instability index: | 39.841 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.159 | ||
Secondary Structure Fraction | |||
| Helix | 0.332 | ||
| turn | 0.239 | ||
| sheet | 0.276 | ||