| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342761.1 | 5prime_partial | 249 | 3-752(+) |
Amino Acid sequence : | |||
| TKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAANILKPALARGELQCIGATTLDEYRKHIEKDPALERRFQPVKVPEPTVDETIQILKGLRERYEIHHKLRYTDEA LVAAAQLSYQYISDRFLPDKAIDLVDEAGSRVRLRHAQLPEEARELERELRQITKEKNEAVRSQDFEKAGELRDREMDLKAQISALIDKNKEMSKAKSEAGDGGPVVTEVDIQHIVSLLD WHPCRESVY* | |||
Physicochemical properties | |||
| Number of amino acids: | 249 | ||
| Molecular weight: | 28,468.961 | ||
| Theoretical pI: | 5.276 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
| Instability index: | 42.633 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.606 | ||
Secondary Structure Fraction | |||
| Helix | 0.281 | ||
| turn | 0.137 | ||
| sheet | 0.337 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342761.1 | 5prime_partial | 249 | 3-752(+) |
Amino Acid sequence : | |||
| TKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAANILKPALARGELQCIGATTLDEYRKHIEKDPALERRFQPVKVPEPTVDETIQILKGLRERYEIHHKLRYTDEA LVAAAQLSYQYISDRFLPDKAIDLVDEAGSRVRLRHAQLPEEARELERELRQITKEKNEAVRSQDFEKAGELRDREMDLKAQISALIDKNKEMSKAKSEAGDGGPVVTEVDIQHIVSLLD WHPCRESVY* | |||
Physicochemical properties | |||
| Number of amino acids: | 249 | ||
| Molecular weight: | 28,468.961 | ||
| Theoretical pI: | 5.276 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
| Instability index: | 42.633 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.606 | ||
Secondary Structure Fraction | |||
| Helix | 0.281 | ||
| turn | 0.137 | ||
| sheet | 0.337 | ||