Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342765.1 | internal | 250 | 2-751(+) |
Amino Acid sequence : | |||
IELDEELSSLPKQKWWEDNYVYQLGGFWHMPQFIKPINRVINNFTPLPNDVILATFPKSGTTWLKSLIYSIINRSSKHMLALQNPHDLVPFLEAQVFAHSDGPSANVDRCRIFGTHIPYQ IMAGILDSCECRVVYLTRNPKDTLISTWHFVNKLNLRKGEPWSLDLAVDQFCHGVFPSGPYYEHVIGYKQLSMKRPEHLMFVTYEEMMEDPSDCVEKLGNFLGCPFERKEEVEEIVKNCP IDVLRMYDVN | |||
Physicochemical properties | |||
Number of amino acids: | 250 | ||
Molecular weight: | 11,671.889 | ||
Theoretical pI: | 11.801 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 75.929 | ||
aromaticity | 0.048 | ||
GRAVY | -0.806 | ||
Secondary Structure Fraction | |||
Helix | 0.190 | ||
turn | 0.362 | ||
sheet | 0.152 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342765.1 | 5prime_partial | 105 | 749-432(-) |
Amino Acid sequence : | |||
SHHTFSIHQWGNSSQSLPLLLSVQTDTLRNYPISPRNRWDPPSSPRTSRTSSALASSCSVVCTRSRARSRAQKGRPHGRTDRPPNQVTMALLSSSSTCLQNATWR* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,671.889 | ||
Theoretical pI: | 11.801 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 75.929 | ||
aromaticity | 0.048 | ||
GRAVY | -0.806 | ||
Secondary Structure Fraction | |||
Helix | 0.190 | ||
turn | 0.362 | ||
sheet | 0.152 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342765.1 | internal | 250 | 2-751(+) |
Amino Acid sequence : | |||
IELDEELSSLPKQKWWEDNYVYQLGGFWHMPQFIKPINRVINNFTPLPNDVILATFPKSGTTWLKSLIYSIINRSSKHMLALQNPHDLVPFLEAQVFAHSDGPSANVDRCRIFGTHIPYQ IMAGILDSCECRVVYLTRNPKDTLISTWHFVNKLNLRKGEPWSLDLAVDQFCHGVFPSGPYYEHVIGYKQLSMKRPEHLMFVTYEEMMEDPSDCVEKLGNFLGCPFERKEEVEEIVKNCP IDVLRMYDVN | |||
Physicochemical properties | |||
Number of amino acids: | 250 | ||
Molecular weight: | 11,671.889 | ||
Theoretical pI: | 11.801 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 75.929 | ||
aromaticity | 0.048 | ||
GRAVY | -0.806 | ||
Secondary Structure Fraction | |||
Helix | 0.190 | ||
turn | 0.362 | ||
sheet | 0.152 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342765.1 | 5prime_partial | 105 | 749-432(-) |
Amino Acid sequence : | |||
SHHTFSIHQWGNSSQSLPLLLSVQTDTLRNYPISPRNRWDPPSSPRTSRTSSALASSCSVVCTRSRARSRAQKGRPHGRTDRPPNQVTMALLSSSSTCLQNATWR* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,671.889 | ||
Theoretical pI: | 11.801 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 75.929 | ||
aromaticity | 0.048 | ||
GRAVY | -0.806 | ||
Secondary Structure Fraction | |||
Helix | 0.190 | ||
turn | 0.362 | ||
sheet | 0.152 |