| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342782.1 | 5prime_partial | 240 | 1-723(+) |
Amino Acid sequence : | |||
| APVLMQATPVTRSPAGLSGEALKTGTSLYLKSIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVSNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKG VDFVGGDMFESVPKADAVMLMWILHDWSDDKCIEILKKCKEAIPASTGKVMIVDAIINEDGEGDEFSGARLSLDMIMLAVMAQGKERTYKEWVHLLNEAGFSKHTIKNIKSIESVIEAYP * | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 18,531.913 | ||
| Theoretical pI: | 11.897 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 93.288 | ||
| aromaticity | 0.124 | ||
| GRAVY | -0.797 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.216 | ||
| sheet | 0.137 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342782.1 | complete | 153 | 642-181(-) |
Amino Acid sequence : | |||
| MHPFLISSLLSLRHHRQHYHIQRQTSTRKLVAFSIFVNYSIYNHHFSGTRWNRFFAFLQNFYAFIVAPVMQYPHEHDRVGFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRKRLH QSPDSRSVAAAHIHHRSQSVKRRRIVAYNGRRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 18,531.913 | ||
| Theoretical pI: | 11.897 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 93.288 | ||
| aromaticity | 0.124 | ||
| GRAVY | -0.797 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.216 | ||
| sheet | 0.137 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342782.1 | 5prime_partial | 240 | 1-723(+) |
Amino Acid sequence : | |||
| APVLMQATPVTRSPAGLSGEALKTGTSLYLKSIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVSNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKG VDFVGGDMFESVPKADAVMLMWILHDWSDDKCIEILKKCKEAIPASTGKVMIVDAIINEDGEGDEFSGARLSLDMIMLAVMAQGKERTYKEWVHLLNEAGFSKHTIKNIKSIESVIEAYP * | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 18,531.913 | ||
| Theoretical pI: | 11.897 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 93.288 | ||
| aromaticity | 0.124 | ||
| GRAVY | -0.797 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.216 | ||
| sheet | 0.137 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342782.1 | complete | 153 | 642-181(-) |
Amino Acid sequence : | |||
| MHPFLISSLLSLRHHRQHYHIQRQTSTRKLVAFSIFVNYSIYNHHFSGTRWNRFFAFLQNFYAFIVAPVMQYPHEHDRVGFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRKRLH QSPDSRSVAAAHIHHRSQSVKRRRIVAYNGRRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 18,531.913 | ||
| Theoretical pI: | 11.897 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 93.288 | ||
| aromaticity | 0.124 | ||
| GRAVY | -0.797 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.216 | ||
| sheet | 0.137 | ||