| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342784.1 | internal | 249 | 3-749(+) |
Amino Acid sequence : | |||
| LALPVLPDPDPAAVQTQTLHRAPPATIPAFPEQSAASGCPLDLPTELFHNIKSACGPKPSSGQLYRSRCCPVLAAWLYAAYSKTALRPPAVRSPPQTASYDMPVLPDDSETCVDTLEKAL GSRGIELGRANETCDLVYCQCGIRLHPFTCSDAFSVNSRGELVGGDAVEKLERDCYSGGGGIGGCSKCLNSLYLLNAERGLINNSTERTSKMHNRDCELMGLTWLLNKDRSTYLHTVSAV LRALMMSTN | |||
Physicochemical properties | |||
| Number of amino acids: | 249 | ||
| Molecular weight: | 12,494.561 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 112.297 | ||
| aromaticity | 0.028 | ||
| GRAVY | -1.094 | ||
Secondary Structure Fraction | |||
| Helix | 0.206 | ||
| turn | 0.308 | ||
| sheet | 0.224 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342784.1 | 5prime_partial | 162 | 1-489(+) |
Amino Acid sequence : | |||
| LSPSPSYPIPTPPPSRPKPSTVRRPPLSPPSRSNPPPLAAPSTSPPNSSTTSNPPADPNPAPVSSTAAAAAPFSPPGSTPPTPKPHCAPPQSDPRPKRRPTICPCCPMTRRRAWTRWRRR WAAGGSSLAGLMRRATSFTANVGLGCTLLLVPTLFLLIPAVN* | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 12,494.561 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 112.297 | ||
| aromaticity | 0.028 | ||
| GRAVY | -1.094 | ||
Secondary Structure Fraction | |||
| Helix | 0.206 | ||
| turn | 0.308 | ||
| sheet | 0.224 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342784.1 | 5prime_partial | 107 | 2-325(+) |
Amino Acid sequence : | |||
| SRPPRPTRSRPRRRPDPNPPPCAARHYPRLPGAIRRLWLPPRPPHRTLPQHQIRLRTQTQLRSALPQPLLPRSRRLALRRLLQNRIAPPRSQIPAPNGVLRYARAAR* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,494.561 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 112.297 | ||
| aromaticity | 0.028 | ||
| GRAVY | -1.094 | ||
Secondary Structure Fraction | |||
| Helix | 0.206 | ||
| turn | 0.308 | ||
| sheet | 0.224 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342784.1 | internal | 249 | 3-749(+) |
Amino Acid sequence : | |||
| LALPVLPDPDPAAVQTQTLHRAPPATIPAFPEQSAASGCPLDLPTELFHNIKSACGPKPSSGQLYRSRCCPVLAAWLYAAYSKTALRPPAVRSPPQTASYDMPVLPDDSETCVDTLEKAL GSRGIELGRANETCDLVYCQCGIRLHPFTCSDAFSVNSRGELVGGDAVEKLERDCYSGGGGIGGCSKCLNSLYLLNAERGLINNSTERTSKMHNRDCELMGLTWLLNKDRSTYLHTVSAV LRALMMSTN | |||
Physicochemical properties | |||
| Number of amino acids: | 249 | ||
| Molecular weight: | 12,494.561 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 112.297 | ||
| aromaticity | 0.028 | ||
| GRAVY | -1.094 | ||
Secondary Structure Fraction | |||
| Helix | 0.206 | ||
| turn | 0.308 | ||
| sheet | 0.224 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342784.1 | 5prime_partial | 162 | 1-489(+) |
Amino Acid sequence : | |||
| LSPSPSYPIPTPPPSRPKPSTVRRPPLSPPSRSNPPPLAAPSTSPPNSSTTSNPPADPNPAPVSSTAAAAAPFSPPGSTPPTPKPHCAPPQSDPRPKRRPTICPCCPMTRRRAWTRWRRR WAAGGSSLAGLMRRATSFTANVGLGCTLLLVPTLFLLIPAVN* | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 12,494.561 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 112.297 | ||
| aromaticity | 0.028 | ||
| GRAVY | -1.094 | ||
Secondary Structure Fraction | |||
| Helix | 0.206 | ||
| turn | 0.308 | ||
| sheet | 0.224 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342784.1 | 5prime_partial | 107 | 2-325(+) |
Amino Acid sequence : | |||
| SRPPRPTRSRPRRRPDPNPPPCAARHYPRLPGAIRRLWLPPRPPHRTLPQHQIRLRTQTQLRSALPQPLLPRSRRLALRRLLQNRIAPPRSQIPAPNGVLRYARAAR* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,494.561 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 112.297 | ||
| aromaticity | 0.028 | ||
| GRAVY | -1.094 | ||
Secondary Structure Fraction | |||
| Helix | 0.206 | ||
| turn | 0.308 | ||
| sheet | 0.224 | ||