Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342784.1 | internal | 249 | 3-749(+) |
Amino Acid sequence : | |||
LALPVLPDPDPAAVQTQTLHRAPPATIPAFPEQSAASGCPLDLPTELFHNIKSACGPKPSSGQLYRSRCCPVLAAWLYAAYSKTALRPPAVRSPPQTASYDMPVLPDDSETCVDTLEKAL GSRGIELGRANETCDLVYCQCGIRLHPFTCSDAFSVNSRGELVGGDAVEKLERDCYSGGGGIGGCSKCLNSLYLLNAERGLINNSTERTSKMHNRDCELMGLTWLLNKDRSTYLHTVSAV LRALMMSTN | |||
Physicochemical properties | |||
Number of amino acids: | 249 | ||
Molecular weight: | 12,494.561 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 112.297 | ||
aromaticity | 0.028 | ||
GRAVY | -1.094 | ||
Secondary Structure Fraction | |||
Helix | 0.206 | ||
turn | 0.308 | ||
sheet | 0.224 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342784.1 | 5prime_partial | 162 | 1-489(+) |
Amino Acid sequence : | |||
LSPSPSYPIPTPPPSRPKPSTVRRPPLSPPSRSNPPPLAAPSTSPPNSSTTSNPPADPNPAPVSSTAAAAAPFSPPGSTPPTPKPHCAPPQSDPRPKRRPTICPCCPMTRRRAWTRWRRR WAAGGSSLAGLMRRATSFTANVGLGCTLLLVPTLFLLIPAVN* | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 12,494.561 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 112.297 | ||
aromaticity | 0.028 | ||
GRAVY | -1.094 | ||
Secondary Structure Fraction | |||
Helix | 0.206 | ||
turn | 0.308 | ||
sheet | 0.224 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342784.1 | 5prime_partial | 107 | 2-325(+) |
Amino Acid sequence : | |||
SRPPRPTRSRPRRRPDPNPPPCAARHYPRLPGAIRRLWLPPRPPHRTLPQHQIRLRTQTQLRSALPQPLLPRSRRLALRRLLQNRIAPPRSQIPAPNGVLRYARAAR* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 12,494.561 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 112.297 | ||
aromaticity | 0.028 | ||
GRAVY | -1.094 | ||
Secondary Structure Fraction | |||
Helix | 0.206 | ||
turn | 0.308 | ||
sheet | 0.224 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342784.1 | internal | 249 | 3-749(+) |
Amino Acid sequence : | |||
LALPVLPDPDPAAVQTQTLHRAPPATIPAFPEQSAASGCPLDLPTELFHNIKSACGPKPSSGQLYRSRCCPVLAAWLYAAYSKTALRPPAVRSPPQTASYDMPVLPDDSETCVDTLEKAL GSRGIELGRANETCDLVYCQCGIRLHPFTCSDAFSVNSRGELVGGDAVEKLERDCYSGGGGIGGCSKCLNSLYLLNAERGLINNSTERTSKMHNRDCELMGLTWLLNKDRSTYLHTVSAV LRALMMSTN | |||
Physicochemical properties | |||
Number of amino acids: | 249 | ||
Molecular weight: | 12,494.561 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 112.297 | ||
aromaticity | 0.028 | ||
GRAVY | -1.094 | ||
Secondary Structure Fraction | |||
Helix | 0.206 | ||
turn | 0.308 | ||
sheet | 0.224 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342784.1 | 5prime_partial | 162 | 1-489(+) |
Amino Acid sequence : | |||
LSPSPSYPIPTPPPSRPKPSTVRRPPLSPPSRSNPPPLAAPSTSPPNSSTTSNPPADPNPAPVSSTAAAAAPFSPPGSTPPTPKPHCAPPQSDPRPKRRPTICPCCPMTRRRAWTRWRRR WAAGGSSLAGLMRRATSFTANVGLGCTLLLVPTLFLLIPAVN* | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 12,494.561 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 112.297 | ||
aromaticity | 0.028 | ||
GRAVY | -1.094 | ||
Secondary Structure Fraction | |||
Helix | 0.206 | ||
turn | 0.308 | ||
sheet | 0.224 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342784.1 | 5prime_partial | 107 | 2-325(+) |
Amino Acid sequence : | |||
SRPPRPTRSRPRRRPDPNPPPCAARHYPRLPGAIRRLWLPPRPPHRTLPQHQIRLRTQTQLRSALPQPLLPRSRRLALRRLLQNRIAPPRSQIPAPNGVLRYARAAR* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 12,494.561 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 112.297 | ||
aromaticity | 0.028 | ||
GRAVY | -1.094 | ||
Secondary Structure Fraction | |||
Helix | 0.206 | ||
turn | 0.308 | ||
sheet | 0.224 |