Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342786.1 | 5prime_partial | 191 | 2-577(+) |
Amino Acid sequence : | |||
HQCHMKAEFQNLGHANEPQSFTAAESTLYGNIMSDFASHAFGVLAEDGFSPATVYSSVNASYTVDYRAPVGNKTVEFSPAEVARVFKYLYQSSANPIFENMTWRQCGEAFAGDIVRYFKE LQPDAQSWLVKSNPVLAGNAPWVALDVTDGLDIRHLNPEEKKVIARAKNHLLRSMQLKGRESLSAEALLES* | |||
Physicochemical properties | |||
Number of amino acids: | 191 | ||
Molecular weight: | 11,381.141 | ||
Theoretical pI: | 8.880 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26845 | ||
Instability index: | 28.923 | ||
aromaticity | 0.121 | ||
GRAVY | 0.078 | ||
Secondary Structure Fraction | |||
Helix | 0.374 | ||
turn | 0.283 | ||
sheet | 0.162 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342786.1 | complete | 99 | 466-167(-) |
Amino Acid sequence : | |||
MPYVKAISNVQSNPWCIPGQNWIGLNQPTLCIWLEFFEIPNNVTGKGFTTLPPCHILENRVCRTLVQVLEHSCNFSWAKFHRLVSYRGSVINSIACIYR* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,381.141 | ||
Theoretical pI: | 8.880 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26845 | ||
Instability index: | 28.923 | ||
aromaticity | 0.121 | ||
GRAVY | 0.078 | ||
Secondary Structure Fraction | |||
Helix | 0.374 | ||
turn | 0.283 | ||
sheet | 0.162 |