| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342793.1 | internal | 245 | 3-737(+) |
Amino Acid sequence : | |||
| TSTDGAYVKPFTSDPISISPGQTIDFLVYADQNPSHYYMASNAYALAGGFDNTTTTARVVYTGDYSPPASPPLPILPNFTDTNASVSFTNQFRSLAYKNHQINVPMNVTTNLLFTISVNI RACPNSDCAGPGGNRLISSINNITFQQPRISILQAYYEMINGVYGDDFPSQPPFPFNYTADVVPQIFWTSSNGTRVRVLDYNATVELVFQGTNIVAPSEHPMHLHGHNFYVVGSGFGNFN RARDA | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 20,228.037 | ||
| Theoretical pI: | 8.552 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23865 | ||
| Instability index: | 65.347 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.393 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.198 | ||
| sheet | 0.209 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342793.1 | complete | 177 | 671-138(-) |
Amino Acid sequence : | |||
| MHRVFAWCHYVCPLKNELHCRIIVKNPHPRPVTRCPKDLRHNICCVIEWKRRLAREIVAIDAIDHLIISLENRDSRLLKRDIVDARDQPIPARPSAVGIRASPDVDRDSEEQIRCHIHRH VNLMVFVGEAAELVGEAHRRVGVGEIGEDWERRRRWRGVISGIDDPSGGGGIVEATS* | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 20,228.037 | ||
| Theoretical pI: | 8.552 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23865 | ||
| Instability index: | 65.347 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.393 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.198 | ||
| sheet | 0.209 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342793.1 | internal | 245 | 3-737(+) |
Amino Acid sequence : | |||
| TSTDGAYVKPFTSDPISISPGQTIDFLVYADQNPSHYYMASNAYALAGGFDNTTTTARVVYTGDYSPPASPPLPILPNFTDTNASVSFTNQFRSLAYKNHQINVPMNVTTNLLFTISVNI RACPNSDCAGPGGNRLISSINNITFQQPRISILQAYYEMINGVYGDDFPSQPPFPFNYTADVVPQIFWTSSNGTRVRVLDYNATVELVFQGTNIVAPSEHPMHLHGHNFYVVGSGFGNFN RARDA | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 20,228.037 | ||
| Theoretical pI: | 8.552 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23865 | ||
| Instability index: | 65.347 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.393 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.198 | ||
| sheet | 0.209 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342793.1 | complete | 177 | 671-138(-) |
Amino Acid sequence : | |||
| MHRVFAWCHYVCPLKNELHCRIIVKNPHPRPVTRCPKDLRHNICCVIEWKRRLAREIVAIDAIDHLIISLENRDSRLLKRDIVDARDQPIPARPSAVGIRASPDVDRDSEEQIRCHIHRH VNLMVFVGEAAELVGEAHRRVGVGEIGEDWERRRRWRGVISGIDDPSGGGGIVEATS* | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 20,228.037 | ||
| Theoretical pI: | 8.552 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23865 | ||
| Instability index: | 65.347 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.393 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.198 | ||
| sheet | 0.209 | ||