Acc_NO	ORF type	length	start-end position (strand +/-)
>DY342795.1	complete	174	185-709(+)
Amino Acid sequence :
MGTVKEAFSLLLQRTNYIISNEPSCQVFADVLKSCAALSDIRLGKSLHAHVIKQGHNVCLLTSKALLNMYAKCRAVNDSRKLFDEITDKDTVTWNTLMSGFACSGSHDRTVMRLFNTLHT ARDPKPSAVTLAVVIPVCTRSGSLGARTSVHAYAIKSGMESQTLRFQVWPRINL*
Physicochemical properties
Number of amino acids:		174
Molecular weight:		19,198.071
Theoretical pI:		9.535
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15470 15845
Instability index:		32.189
aromaticity		0.063
GRAVY		-0.001
Secondary Structure Fraction
Helix		0.299
turn		0.218
sheet		0.247